skill GitHub

nifi-and-ai: Claude Skill for Building and Debugging Apache NiFi 2.x Flows

A Claude Code skill for working with Apache NiFi 2.x, MiNiFi, and EFM data flows. Covers building, deploying, and debugging flows rather than only generating config snippets. Niche, but a clean example of packaging domain-specific ops knowledge as a skill.

nifidata-engineeringdevopsskill
by cldr-steven-matison Aug 15, 2026 6/10
skill GitHub

design-taste: 24 Agent Skills That Encode Visual Taste as Instructions

Twenty-four open-source agent skills that translate design taste into explicit instructions, organized as ten genre identities. Each identity ships a before/after demo built from the same brief, so you can see exactly what the skill changes. A concrete answer to the complaint that agent-generated UI all looks the same.

designuiskillsfrontend
by madebymustafa Aug 15, 2026 7/10
skill GitHub

test-audit: Skill Giving a Plain-Language Ship or Don't-Ship Verdict

A /test-audit slash command that reviews the tests covering AI-written code and returns a verdict in plain language instead of a coverage percentage. Aimed at people shipping code they did not hand-write and cannot easily judge. Low ceremony: one command, one answer.

testingslash-commandcode-qualityvibe-coding
by gtskevin Aug 15, 2026 6/10
skill GitHub

dotagents: Portable Skills, Commands, and Templates for Agent Harnesses

A personal collection of agent skills, slash commands, design examples, and project templates written to work with Claude Code and most other harnesses. Useful as a reference for structuring your own dotfiles-style agent config. Note that two unrelated projects also use the dotagents name.

skillscommandstemplatesdotfiles
by thefilesareinthecomputer Aug 15, 2026 6/10
skill Reddit

Use a Claude Code Skill Without Installing It — Just Hand Over the Path

Claude Code auto-loads skills only from ~/.claude/skills/, which breaks when shared skills live in ~/.agents/skills/ for other agents. Rather than copying, symlinking, or running an rsync daemon to keep both in sync, the post notes that a skill is just a folder with a SKILL.md — so you can tell Claude to read it at its absolute path mid-conversation. Avoids duplicate copies and the ambiguity of which one actually loads.

skillstechniqueno-installmulti-agent
by Annual_Variation_916 Aug 15, 2026 6/10
skill GitHub

walk-route-3d: Skill Generating Walkable 3D Tokyo Routes as Standalone HTML

A skill that takes a start and end point and generates a self-contained HTML file letting you walk the route across Tokyo's PLATEAU 3D city model. No routing API and no tile server needed — everything ships inside the one file. Documentation is in Japanese; a strong demo of how much a single skill can carry.

3dmapshtmlplateaujapanese
by kofujimura Aug 15, 2026 6/10
skill GitHub

polish-open-source-prose: Edit OSS Docs Without Losing Facts or Voice

An agent skill for Claude Code and Codex that copy-edits open-source prose — READMEs, docs, announcements — under the constraint of preserving factual claims and the author's voice. Includes zh-Hant-TW support. Targets the common failure where an LLM rewrite flattens tone and quietly changes facts.

documentationwritingreadmei18n
by ting-hong-shieh Aug 15, 2026 6/10
skill Reddit

Three Escalating Fixes for Opus 5's Verbose Output

Ranked remedies for over-long Claude Code replies, from weakest to strongest. The key insight is that abstract instructions like 'be concise' barely register, while rules that specify output shape do: lead with the answer, carry multi-item results in tables or bullets, cap unbroken prose at two paragraphs. Output styles beat CLAUDE.md because they modify the system prompt directly instead of riding in as a user message.

claude-mdoutput-styleverbositypromptingopus-5
by cleverhoods Aug 14, 2026 7/10
skill GitHub

question-surface: Answer All of an Agent's Questions on One Screen

When an agent has eight clarifying questions, it normally asks them one at a time across a long chat. This renders them together in a local, dependency-free web form with the tradeoffs shown next to each choice, so you answer once with full context. Includes a Claude Code skill for wiring it in.

clarificationuxformsskill
by avanrossum Aug 14, 2026 7/10
skill Reddit

/retro: Single-File Skill That Compounds Session Lessons Into Rules

A dependency-free SKILL.md run at the end of every session. It demands an honest review citing specific corrections from the actual conversation, then routes at most three lessons by type: context gaps go to the memory file, recurring procedures become skills, and hard always/never constraints become rule files or deterministic hooks. The routing is the point, since enforcement beats instructions.

retrospectiveskillruleshookslearning
by Anti17 Aug 14, 2026 7/10
skill GitHub

anchor: Project Memory That Only Records What It Can Prove

Addresses Claude Code rebuilding code that already exists and retrying approaches that already failed. Anchor writes down only claims it can verify, drops a note the moment the code it describes changes, and retires instruction files superseded by newer ones. The self-invalidation is what separates it from a memory file that quietly rots into misinformation.

memorycontextsession-continuitystaleness
by alrox360 Aug 14, 2026 7/10
skill GitHub

goshipit: 188-Check Pre-Deploy Audit Skill for Claude Code

Runs a codebase audit before every deploy across 14 categories: leaked secrets, XSS, SQL injection, rate limiting, test coverage, bundle size, WCAG accessibility, SEO, Stripe webhooks, and GDPR among them. Works entirely from source, so no staging URL is needed. A reasonable last gate for solo developers shipping without a review process.

securityauditpre-deployaccessibilityskill
by Capta1nRaj Aug 14, 2026 7/10
skill GitHub

project-change-router-skill: Routes Changes to the Right Module in Big Repos

A skill for Claude Code and Codex that governs where a change should land in a large full-stack codebase. It helps the agent find the correct capability boundary, avoid re-implementing something that already exists, and respect write constraints on protected areas. Useful if your agent keeps creating duplicate helpers instead of extending existing ones.

skillmonorepocode-reusecodexgovernance
by WeirdSky924 Aug 14, 2026 6/10
skill GitHub

pm-skills: 68 Product Management Skills With Sub-Agents and Workflows

A large plug-and-play skill pack covering product management: 30 Triple Diamond phase skills, 11 foundation, 12 utility, and 15 tool skills including Foundation Sprint and Design Sprint. Ships with 6 sub-agents, workflows, 200+ sample outputs, and CI-enforced contracts so the skills stay consistent. Apache 2.0.

skillproduct-managementsubagentsworkflowapache-2.0
by product-on-purpose Aug 14, 2026 7/10
skill GitHub

agent-kit: Shared Safety-Conscious Resources for Codex and Claude Code

A collection of reusable agent resources meant to be shared across both Codex and Claude Code, with an emphasis on safety-conscious defaults. Useful as a starting point if you work in both tools and want one set of conventions instead of two. Generic in scope — worth a skim rather than a wholesale adoption.

skillcodexsafetyshared-configportable
by kimgea Aug 14, 2026 5/10
skill GitHub

no-misread: Lints Prompts for Ambiguity and Output for AI Tells

A linter and Claude skill that works on the text on both sides of the model. On input it flags the ambiguity a model will quietly guess its way through; on output it catches invisible watermark characters, machine rhythm, and other AI tells. Supports English and Chinese.

skilllinterprompt-engineeringwritingwatermark
by ryvn-dev Aug 14, 2026 7/10
skill GitHub

evidence-based-copywriting: Marketing Copy Gated on Fetched Sources

A copywriting workflow that requires every factual claim in marketing copy to be traced back to a fetched source before publishing, with adversarial checks to catch unsupported statements. Aimed at teams who want agent-written copy that will not invent specs, numbers, or customer results.

copywritingmarketingverificationfact-checkingskill
by mucinous-riposte867 Aug 14, 2026 6/10
skill GitHub

ai-drama-pipeline: Four Claude Code Skills for AI Short-Drama Production

A Korean-language bundle of four Claude Code skills covering the whole AI short-drama pipeline: script, per-cut prompts, video generation, then QC and assembly. Distributed through the Hamlog marketplace. Worth a look as a template for chaining several skills across a multi-stage creative workflow.

skillvideopipelinekorean
by uyuni0217sh-design Aug 14, 2026 5/10
skill GitHub

ultimate-viral-writer: Viral-Copy Skill With Industrialized Headline Tests

A Chinese-language writing skill that packages influencer strategy, natural-sounding phrasing, and systematic headline A/B testing into one Claude Code skill. Aimed at content creators rather than developers. A concrete example of encoding an editorial methodology as a skill.

skillwritingcontentchinese
by tanchunzhuo Aug 14, 2026 5/10
skill GitHub

using-lwc: Source-Grounded Project Memory Skill Built on a Document Graph

A memory skill for AI agents that grounds recall in actual sources via an LWC Wiki, document graphs, and CodeGraph. The goal is durable project memory that does not drift from the code. Pairs with the author's llm-wiki-cli for the CLI side.

skillmemoryknowledge-graphcontext
by JanYork Aug 14, 2026 6/10
skill Reddit

What I Learned Writing 15 Claude Code Skills, Including What I Got Wrong

A practitioner writeup on skill authoring after building fifteen of them. Key findings: the description field does nearly all the triggering work, vague descriptions never fire, and happy-path instructions in the body are wasted since the model would do that anyway. Includes the mistakes the author had to unlearn.

skillauthoringlessonsreddit
by Wilddocofficial Aug 14, 2026 8/10
skill GitHub

funbox-plugins: A Claude Code Marketplace of Independently Versioned Plugins

A small but growing Claude Code plugin marketplace where each plugin is self-contained and versioned on its own. Install only what you need rather than a monolithic bundle. Good example of the modular end of the marketplace spectrum.

marketplacepluginsskillsmodular
by nthansen Aug 14, 2026 6/10
skill GitHub

claude-global-skills: Machine-Wide Skills for Review Loops and Session Resume

A curated skill collection covering a code-review loop, local chat-history search, session end and resume, Gemini image generation, and transcript retrospectives. Everything runs machine-wide with only Python and Node as prerequisites. A solid starting set if you are building a personal skill library.

skillscode-reviewsessionscollection
by BryceEWatson Aug 14, 2026 7/10
skill GitHub

plainspeak: Plain-Language Mode for Non-Developers Using Claude Code

Puts Claude Code into plain-language mode so people without a dev background can still ship real products. Strips jargon out of explanations and prompts. Aimed squarely at the vibe-coding crowd.

skillaccessibilityplain-languagebeginners
by mkt-henry Aug 14, 2026 6/10
skill GitHub

writing-skills: Plain Language, GOV.UK, AP Style, and STE-100 as Skills

Turns official writing frameworks (plain language, business writing, GOV.UK, AP style, STE-100, developer docs) into procedural agent skills, plus a set of character voices. Ships as Agent Plugins 1.0.0 and works in opencode, Claude Code, and Codex. Better than pasting a style guide into every prompt.

skillwritingstyle-guidedocs
by surendranb Aug 14, 2026 6/10
skill GitHub

evidence-research-report: Research Skill With Deterministic Citation Checks

An evidence-first research-report skill for Claude Code and Codex that works under a bounded search budget and verifies citations deterministically. Stops the agent from spending unbounded time searching or fabricating sources. Good fit for reports that need to survive scrutiny.

skillresearchcitationsevidence
by royalskynet Aug 14, 2026 6/10
skill GitHub

specback: Multi-Agent Reverse Spec Generator That Turns Code Into Specs

Runs code through a multi-agent pass to reconstruct the specification it implements. Works with Claude Code, Codex, OpenCode, Copilot, and Cursor. Useful for inherited codebases where no written spec ever existed.

skillspecreverse-engineeringmulti-agent
by nekolife1984 Aug 14, 2026 6/10
skill GitHub

shiarauzo/skills: Packaged Workflows You Stop Re-Explaining to Claude Code

Agent skills built from the workflows the author ran often enough that re-explaining them became the bottleneck. That origin story is the strongest signal for which workflows are worth packaging. A practical reference for choosing what to turn into a skill.

skillsworkflowautomationcollection
by shiarauzo Aug 14, 2026 5/10
skill GitHub

claude-chart-dashboard: Turn Any Data Into an Offline HTML Dashboard

A Claude Agent Skill that converts any dataset into a self-contained HTML dashboard or report with interactive SVG charts. Zero dependencies and works offline, so the output is a single shareable file. Ships as a Claude Code plugin.

skilldashboardchartsvisualization
by raghuramsirigiri Aug 14, 2026 7/10
skill GitHub

WorkbuddySkillGroups4DSH: 44 Expert-Team Skill Bundles Ported to DSH

Repackages the WorkBuddy expert-team skills as a DeepSeek Harness plugin: 44 multi-role SKILL.md bundles installable to ~/.dsh/skills with Cordis plugin registration. Shows how a Claude-style skill collection ports to another harness. Bilingual documentation.

skillsdshportmulti-role
by darker2016 Aug 14, 2026 5/10
skill GitHub

awesome-agent-harness: Curated Skill List Spanning Seven Coding Agents

A curated list of useful Agent Skills for Claude Code, Codex, Gemini CLI, OpenClaw, Hermes, and other agents. Useful as a discovery index rather than something you install. Handy when you want to see what already exists before writing your own.

awesome-listskillsdiscoverycurated
by zients Aug 14, 2026 6/10
skill GitHub

dev-skills: Laravel Standards Packaged as AI Coding Skills

AI skills that encode Laravel conventions and standards so agents write framework-idiomatic code. Narrow by design. Useful template if you want to do the same for another framework.

skilllaravelphpstandards
by jotafurtado Aug 14, 2026 5/10
skill GitHub

report-helper: One Sentence In, a Full Research Report PDF Out

A research and writing assistant for long-form deep research reports that runs the whole pipeline from a single prompt and emits a formatted PDF. Chinese-language. Useful if your deliverable is a document rather than code.

skillresearchpdfchinese
by Jiaranbb Aug 14, 2026 5/10
skill Reddit

ui-ideation-lab: A Lazy Senior Designer Mode That Cuts 6x Less Bloat

Two Claude Code skills in one: redesign-studio produces three or four distinct design directions, and impeccable checks each output against real design standards. Both ask whether the pattern already exists or a native element would do before generating anything. Outputs HTML files, a compare page, and notes -- an ideation tool, not a production pipeline.

skilldesignuiideation
by for_blues_ Aug 14, 2026 7/10
skill GitHub

threadwave-skill: Review-Gated Bilingual X Automation Skills

A bilingual skill suite for Twitter/X automation powered by ThreadWave, with a review gate before anything is published. The gate matters: unattended posting is how accounts get flagged. Relevant if you run social automation from an agent.

skilltwitterautomationreview-gate
by ohmyskyhigh Aug 14, 2026 5/10
skill GitHub

claude-stack: A Shipping Solo Builder's 156 Skills, 6 Hooks, and Router

A working Claude Code configuration published whole: 156 skills, 6 hooks, a conductor routing pattern, and an auto-dedupe watcher. Value is in seeing how the pieces fit at scale rather than installing all of it. The routing pattern is the most transferable part.

configskillshooksrouting
by bertbertov Aug 14, 2026 7/10
skill GitHub

second-brain-starter-kit: 101 Skills Turning Claude Code Into a Second Brain

All 101 skills behind the author's Claude Code second brain, plus a working CRM engine, vault templates, and a handover map. Ships the method rather than the personal data. Substantial starting point if you want agent-managed personal knowledge.

skillssecond-brainknowledgecrm
by tonydzi Aug 14, 2026 6/10
skill GitHub

guide-forge: Turn Your Idea Into a Gated, Learn-As-You-Go Build Guide

A Claude Code plugin that plans a gated milestone ladder for your own project idea, then drafts atomic step files explaining every action at the point it happens. Aimed at learning while building rather than getting handed a finished repo. Good for onboarding onto unfamiliar stacks.

pluginlearningmilestonesguide
by tomthebearded Aug 14, 2026 6/10
skill GitHub

cue: Record Requirements, Design, and Rejected Alternatives Beside Code

Claude Code plugins where cue-dev writes the requirement, design, rejected alternatives, and outcome next to the code they produced, so any line traces back to its reasoning. Attacks the biggest gap in agent-written code: nobody remembers why. Lightweight compared to full ADR processes.

plugindocumentationtraceabilitydecisions
by FrogBaek Aug 14, 2026 6/10
skill GitHub

shidi-skill: A Junior Lab Mate Skill for Literature Review and Figures

An agent skill that plays the role of a junior lab mate: literature research, experiment design, figure production, and paper reading, delivering files rather than chat. Results are meant to be cross-verifiable and it has no dependencies. Aimed at academic workflows.

skillresearchacademicfigures
by IcyCreamDAS Aug 14, 2026 5/10
skill GitHub

epicsagas/plugins: A Marketplace for Claude Code Skills and Commands

A Claude Code plugin marketplace for discovering and installing skills, commands, and agent configurations. Another entry in a crowded category. Browse before installing to see whether the catalog overlaps what you already run.

marketplacepluginsskillscommands
by epicsagas Aug 14, 2026 5/10
skill GitHub

reoclo/skills: On-Demand Reference Guides Shared Across Skill-Aware Agents

Shared agent skills for Reoclo tooling, written as reference guides that Claude Code and other skill-aware agents load on demand. Vendor-specific but a clean example of the load-when-needed pattern. Small footprint until invoked.

skillsreferenceon-demandshared
by reoclo Aug 14, 2026 5/10
skill GitHub

AgentSmithy: Distributable Skills for Screenshots, Transcripts, and Gifts

A distributable skill collection for Codex, Claude Code, and similar agents: screenshot to Markdown, video and audio transcription, pre-publish risk checks for Xiaohongshu, and evidence-based gift selection. An unusually eclectic mix. Chinese-language documentation.

skillsocrtranscriptionchinese
by BambooXiu Aug 14, 2026 5/10
skill GitHub

visualkan: Turn Any Content Into Whiteboards, Infographics, and Mind Maps

Converts arbitrary content into a visual explanation: whiteboard, infographic, presentation, diagram, mind map, or UI mockup. Installs as a skill into AI coding assistants. Useful when the deliverable is a picture rather than prose.

skillvisualizationdiagramsinfographics
by dapih Aug 14, 2026 6/10
skill GitHub

socratic: A Seven-Question Post-Ship Retrospective for Claude Code

A retrospective skill that asks seven questions after you ship, built around confidence, blind spots, and decay. Structured enough to run every time without becoming a chore. Pairs well with the same author's other review skills.

skillretrospectivereviewreflection
by robcsaszar Aug 14, 2026 6/10
skill GitHub

prose: Write in Channel Voice and Scrub AI Patterns From Existing Text

Drafts new content in the right voice for each channel, or scans existing text for AI tells and rewrites it in an authentic human voice. Two directions in one skill: generate and remediate. Useful for anyone publishing agent-assisted writing.

skillwritingvoiceediting
by robcsaszar Aug 14, 2026 6/10
skill GitHub

crucible: Parallel-Agent Codebase Audit That Adversarially Verifies Itself

Runs a parallel-agent audit over a codebase, then has agents adversarially try to refute each finding before it is reported. The verification step is what keeps plausible-but-wrong findings out of the output. A good pattern to copy even if you do not use the skill.

skillauditparallel-agentsverification
by robcsaszar Aug 14, 2026 7/10
skill GitHub

scaffold: Skills for Authoring AGENTS.md, CONTEXT.md, and DESIGN.md

Claude Code skills that write the three files agents rely on most: AGENTS.md, CONTEXT.md, and DESIGN.md. Removes the blank-page problem when setting up a new repo for agent work. Small and focused.

skillagents-mddocumentationscaffolding
by robcsaszar Aug 14, 2026 6/10
skill GitHub

ai-forge: The Full Skill-Authoring Lifecycle, From Create to Regression Eval

Claude Code skills covering the whole skill-authoring lifecycle: create, judge, eval with persisted regression suites, audit for ecosystem-wide coherence, review, and update. The persisted regression suites are the standout, since most skill authoring has no test loop at all. For people maintaining many skills rather than a handful.

skillauthoringevalregression
by robcsaszar Aug 14, 2026 7/10
skill GitHub

dsh-skills: Parallel Dispatch and Zero-LLM Architecture Mapping for DSH

A DeepSeek Harness skill pack with parallel-dispatch scheduling rules and an archmap agent that computes deterministic diff impact surfaces without calling an LLM, saving tokens. The zero-LLM impact analysis is the interesting idea. Chinese-language documentation.

skillsdshparallelarchitecture
by xu-jin-cs Aug 14, 2026 5/10
skill GitHub

ai-readiness-assessment: Score Your Team Against an Agentic Maturity Model

A self-contained Claude Code and GitHub Copilot plugin that assesses team AI readiness against the Agentic Habitat Maturity Model and the Sovereign Engineer framework, producing a gap-anchored maturity report. Aimed at engineering leads rather than individual developers. Opinionated about which frameworks matter.

pluginassessmentmaturityteam
by techtalk Aug 14, 2026 5/10
skill GitHub

Cluide: Guides, Setup Tasks, and Templates for Building Claude Assistants

A framework for building, maintaining, and improving AI assistants with Claude, combining guides, runnable setup tasks, installable skills, and copy-paste templates. Broad rather than deep. Useful as a structured starting point if you are new to assembling assistants.

frameworktemplatesskillsguides
by KalastajaM Aug 14, 2026 5/10
skill GitHub

oss-launch: Generate Every Open Source File a Repo Needs to Launch

A skill that scans a repo, asks only what it cannot infer, then generates README, LICENSE, contributing, security, changelog, CI, and a launch playbook. The ask-what-you-cannot-infer step keeps the output from being generic filler. Useful right before making a repo public.

skillopen-sourcereadmelicensing
by AnayDhawan Aug 14, 2026 6/10
skill GitHub

docdna: Backfill Docs the Code Can Prove and Flag the Ones It Contradicts

Decides which documents a repo owes, flags the existing ones that now contradict the code, and writes the ones the code can prove, with citations. Portable across Claude Code, Codex, Cursor, and Windsurf. The citation requirement is what separates it from generic doc generators.

skilldocumentationcitationsbackfill
by hannsxpeter Aug 14, 2026 7/10
skill GitHub

dsh-mattpocock-skills: Matt Pocock's 25 Skills Ported to DeepSeek Harness

An unofficial DSH port of mattpocock/skills, bundling 18 engineering and 7 productivity skills as a DeepSeek Harness plugin. MIT licensed with credit to the original author. Shows how portable well-written skills are across harnesses.

skillsdshportengineering
by xiaoxiaosrm Aug 14, 2026 5/10
skill GitHub

playcanvas/skills: Official PlayCanvas Skills for AI Coding Agents

Reusable skills published by PlayCanvas for agents working with their products. First-party skills are worth noting as a trend: the vendor encodes its own API conventions rather than leaving agents to guess. Useful if you build with PlayCanvas.

skillsplaycanvasgamedevfirst-party
by playcanvas Aug 14, 2026 6/10
skill GitHub

natural-talk: A Ruleset That Strips AI-Speak Out of Model Output

A complete ruleset for removing AI phrasing, lecture tone, and collaboration filler from model responses, usable with Claude, ChatGPT, and other conversational AI. Bilingual documentation. Broader than a coding skill but directly applicable to agent-written prose.

skillwritingtoneprompting
by chengzhi-c Aug 14, 2026 6/10
skill GitHub

claude-code-system-prompts: Every System Prompt and Tool Description, Versioned

A complete extraction of Claude Code's system prompt, its 27 builtin tool descriptions, subagent prompts for Plan/Explore/Task, and utility prompts for CLAUDE.md, compaction, statusline, WebFetch, Bash, security review, and agent creation. Updated for each Claude Code release. Essential reference if you write skills or subagents and want to match the house style.

referencesystem-prompttoolsinternals
by Piebald-AI Aug 14, 2026 8/10
skill GitHub

gemini-cli-extensions/spanner: Agent Skills for Google Cloud Spanner

Skills for working with Google Cloud Spanner, published under the gemini-cli-extensions org. Another first-party vendor skill set, portable to any skill-aware agent. Narrow but authoritative for Spanner work.

skillsspannergcpdatabase
by gemini-cli-extensions Aug 14, 2026 5/10
skill GitHub

gen-ai-skills: Picsart's Shared Skills and Prompts for Generative Workflows

Shared skills, prompts, and tooling for Picsart's gen-ai CLI and generative AI workflows. A company-internal skill library published openly. Mostly of interest as an example of how an organization structures shared skills.

skillsgenerative-aipicsartprompts
by PicsArt Aug 14, 2026 5/10
skill GitHub

Hemusci-Skills: A Chinese Skill Library for Research Writing and Analysis

A continually expanding professional agent skill library aimed at research writing, data analysis, and professional report delivery. Chinese-language. Relevant if your agent work is document-heavy rather than code-heavy.

skillsresearchreportschinese
by SoMic520 Aug 14, 2026 5/10
skill GitHub

brain-starter: A Claude Code-Powered Second Brain Template for Obsidian

An Obsidian second-brain template driven by Claude Code, shipping skills, auto-linking, and note conventions. Lighter than the 101-skill kits in the same space. A reasonable entry point if you already use Obsidian.

skillobsidiansecond-brainnotes
by michaeljauk Aug 14, 2026 6/10
skill GitHub

dsh-output-styles: Claude Code Output Styles Ported to DeepSeek Harness

Brings Claude Code outputStyles to DeepSeek Harness as session-scoped, durable, runtime-switchable styles, with a /style command, an output_style storage domain, and systemPrompt injection. Runtime switching without restarting the session is the useful bit. A clear reference for how output styles are wired.

output-stylesdshportprompting
by PerryLink Aug 14, 2026 5/10
skill GitHub

honest-skills: Agent Skills That Force a Model to Report What It Cannot Do

Two skills with teeth: root-cause forbids a causal claim without evidence, and sitrep puts the finding first, bad news above good, and names every gap. It ships clarity.py so the rules run as a check rather than sitting in the prompt as advice. Directly aimed at agents that overstate confidence.

skillhonestyreportingverification
by openhonest Aug 14, 2026 7/10
skill GitHub

openagentskills: A Community Library of Skills for Five Coding Agents

A community-driven library of reusable agent skills covering Claude Code, Cursor, Codex, Cline, and others. Community-maintained means variable quality, so read before installing. Useful as a discovery surface.

skillscommunitylibrarymulti-agent
by Notysoty Aug 14, 2026 6/10
skill GitHub

best-practice-skill: Anthropic Build Guidelines as an Agent Skill

An Agent Skill that encodes Anthropic's documented best practices for building with Claude. It advises on model and effort selection, prompt construction, subagent delegation, tool design, evaluation, and guardrails. A convenient way to keep official guidance in the loop while designing agent systems.

skillbest-practicespromptingsubagentstool-design
by starsinc1708 Aug 14, 2026 6/10
skill GitHub

skillary: Hub Index for 321 Claude Skills Across 11 Repos

A directory that indexes 321 Claude skills spread across eleven category repositories. You browse the full list in one place and then clone only the category you need, instead of pulling down everything. Handy for finding an existing skill before writing your own.

skillsdirectoryindexcatalog
by prvthmpcypher Aug 14, 2026 6/10
skill GitHub

skills-business: 29 Claude Skills for Business Workflows

A collection of 29 skills covering non-engineering work — project management, OKRs, SOPs, meeting summaries, proposals, and negotiation. Useful if you want Claude Code handling the operational paperwork around a project rather than just the code.

skillsbusinessokrsopproject-management
by prvthmpcypher Aug 14, 2026 5/10
skill GitHub

msu-skills: SKILL.md Catalog for MapleStory Universe Builders

An official NEXPACE catalog of agent skills for building on MapleStory Universe. It is distributed as plain SKILL.md files, so it works with Claude Code, Codex CLI, Gemini CLI, Kimi CLI, or any agent that reads the format. A good example of a vendor shipping first-party skills for their platform.

skillsgamedevmaplestoryvendorskill-md
by NEXPACE-Limited Aug 14, 2026 5/10
skill GitHub

claude-skills-realestate: Listing Copy and Fair Housing Compliance Screening

A free set of Claude skills for real estate agents, covering listing copy and MLS remarks. The more interesting piece is compliance screening against Fair Housing and state advertising rules, which turns the skill into a check on generated marketing text rather than just a generator.

skillsreal-estatecompliancecopywriting
by trevormchaffie Aug 14, 2026 5/10
skill GitHub

IncredAgents: Catalog Site for Claude Code SKILL.md Agent Skills

A documentation and catalog site for the IncredAgents collection of SKILL.md skills for Claude Code and compatible agents. Every skill gets its own page with real output demos, so you can see what it produces before installing. Useful for browsing skills without cloning repos first.

skillscatalogdocsskill-md
by MyAiFreedomSystems Aug 13, 2026 5/10
skill GitHub

claude-freelancer-skills: Five MIT Skills for Freelancer Operations

A free set of five Claude Code skills covering invoice chasing, proposals, client onboarding, status updates, and renewals. The focus is the admin side of freelancing rather than writing code. MIT licensed and drop-in for anyone running a solo practice.

skillsfreelanceinvoicingproposalsbusiness
by simoabdelmoumen10-sys Aug 13, 2026 6/10
skill GitHub

quiz-me-skill: Makes Claude Quiz You on the Bug Before It Writes Code

A Claude Code plugin that interrupts the usual fix-it-immediately loop by quizzing you on root cause and intended fix first. The goal is to keep your understanding of the codebase from decaying while the agent does the typing. A deliberate inversion of the normal agent workflow, aimed at learning.

pluginlearningdebuggingroot-cause
by schwann2402 Aug 13, 2026 7/10
skill GitHub

straightedge: Design Execution Engine With Computed WCAG Gates

A design skill for Claude Code, Cursor, and Codex that enforces computed WCAG contrast gates, a 22-shape catalog with rotation memory, and a ship scan blocking generic output and invented statistics. Covers web, print, brand identity, packaging, and apparel. Aimed at stopping agents from emitting the same slop layout every time.

designwcagaccessibilitybrandingskill
by iamAlvinV Aug 13, 2026 6/10
skill Reddit

Web-Design-Skills: A Two-Prompt Skill Suite From Site Discovery to Launch

A portable Agent Skills suite for Claude Code, Cursor and other coding agents that covers a website end to end in two prompts instead of fifty. The first prompt produces a blueprint — product goals, users, top tasks, content, visual direction, risks and acceptance criteria — before any code is written. The second builds and releases against that approved blueprint, with accessibility, SEO, privacy and QA treated as gates rather than afterthoughts.

skillsweb-designaccessibilityseoworkflow
by Both_Animator_1120 Aug 13, 2026 7/10
skill Reddit

ArcForge: A Review Gate for Claude Code Architecture Changes

An open-source set of Agent Skills that adds a second pass over architecture work: ask Claude Code to propose or modify an architecture, then review the resulting RFC, ADR or diagram before implementation begins. The gate returns evidence gaps, adversarial findings, blockers with a score, and a verdict with explicit approval conditions. It also ships a general production-architecture skill and a separate one for AI-agent system architecture, both instruction-first and portable.

skillsarchitecturecode-reviewadrrfc
by FunNewspaper5161 Aug 13, 2026 7/10
skill GitHub

architecture-decisions: Claude Code Skills for AWS and DevOps ADRs

A set of Claude Code skills for recording infrastructure decisions as architecture decision records, aimed at AWS and DevOps work. Each decision is evaluated against the AWS Well-Architected Framework and CALMS/DORA rather than captured as free-form prose, which gives the agent an explicit rubric to argue against. Handy if your team already keeps ADRs but writes them inconsistently.

skillsadrawsdevopswell-architecteddora
by eenlpe1 Aug 13, 2026 6/10
skill GitHub

clinpharm-pmx-skills: Agent Skills for Clinical Pharmacology and Pharmacometrics

An open Agent Skills library that turns a coding agent into a clinical pharmacology and pharmacometrics assistant. It reviews, reconciles and prepares evidence, with hard boundaries stated up front: it never selects a dose, signs off, or submits. The repo also tracks honest built-versus-released status per skill, which is unusual and worth copying for any regulated-domain skill pack.

skillsclinical-pharmacologypharmacometricshealthcareregulated
by malekokour Aug 13, 2026 6/10
skill GitHub

radar-suite: Five Claude Code Audit Skills for Swift and SwiftUI Apps

A one-install bundle of five audit skills that form a complete pipeline for finding bugs in Swift and SwiftUI apps before shipping. Each skill covers a distinct audit dimension rather than running a single generic review, which tends to surface more than one broad pass does. Aimed squarely at iOS and macOS developers using Claude Code.

skillsswiftswiftuiiosauditcode-review
by Terryc21 Aug 13, 2026 7/10
skill GitHub

magros.ai-skills: Portuguese-Language AI Skills Bundle Built on ECC

A skills bundle combining an ECC base with original Portuguese-language skills — engenharia-de-grafos for graph engineering, doctor for diagnostics, grills, and score-loop for iterative scoring. One of relatively few skill packs authored natively in Portuguese rather than translated, which matters for prompt phrasing quality.

skillsportuguesebundlegraphsscoring
by majinmagros Aug 13, 2026 5/10
skill Reddit

Unforget: Collapse Scattered TODOs and Plan Files into One UNFORGET.md

Deferred work usually ends up spread across a Deferred.md, inline TODOs, plan files, and memory files that disagree with each other. The Unforget skill sweeps the codebase and consolidates everything into a single UNFORGET.md, sorted into four categories: plan deferrals, spillovers, audit findings, and bugs. Each item gets a target column tied to your release cycle, so a ship-blocker flag means something concrete.

skilltodo-trackingrelease-managementcontext
by BullfrogRoyal7422 Aug 13, 2026 7/10
skill GitHub

Scriptorium: French Professional Writing Workshop for Claude with 26 Genres

Scriptorium is a French-language writing studio for Claude Code and Cowork, covering 26 source genres with a strict house style. Guardrails are deterministic and written in pure Python rather than left to the model. It exports finished work to Word, PDF, HTML, and LaTeX against a defined visual identity.

writingfrenchdocument-generationguardrails
by MariusYvard Aug 13, 2026 5/10
skill GitHub

Banka: Skills Kit for Scoping Claude Code Projects at the Right Complexity Tier

Banka is a protocol plus skills kit for scoping, generating, and building Claude Code projects without over- or under-engineering them. It sorts work into complexity tiers and matches the build approach to the tier. It stays agnostic about your stack while being deliberately opinionated about quality.

skillsscopingproject-setupquality
by partikularwaters Aug 13, 2026 6/10
skill GitHub

autonomous-engineer: Meta-Skill with Evaluator Loops and Workspace Sandboxing

autonomous-engineer is a meta-skill aimed at pushing coding agents toward staff-level autonomy across Claude Code, Cursor, Zed, OpenHands, and Codex. It combines context engineering, spec-driven development, and three-layer evaluator loops with an explicit graph topology for task decomposition. Evaluation-driven development against golden datasets and rigid workspace sandboxing round it out.

meta-skillspec-drivenevaluationsandboxing
by johngbl Aug 13, 2026 6/10
skill GitHub

claude-github-security-audit: Seven-Dimension Risk Audit Before Adopting a Repo

This skill audits a GitHub repository for risk before you pull it into your stack, which matters more as agents install third-party plugins and skills on your behalf. It scores across seven weighted dimensions covering maintenance, provenance, and code quality signals. The output is a single ADOPT, EVALUATE, CAUTION, or AVOID verdict rather than a wall of raw findings.

securitysupply-chainauditdependency-review
by Consultora-AMDT Aug 13, 2026 7/10
skill GitHub

claude-code-project-pack: 23 Subagents and 21 Skills for Japanese Contract Dev

A Claude Code project pack built for Japanese contract software development, aligned with the IPA Common Frame 2013 process model. It ships 23 subagents and 21 skills alongside QCD and security governance standards. The pack assumes you will tailor it to each engagement rather than adopt it wholesale.

subagentsskillsjapanesegovernance
by CT-masato-hino Aug 13, 2026 6/10
skill GitHub

second-reader: A Knowledge Vault Where Every Note Is Verified Against Its Source

second-reader is a knowledge vault skill for AI agents built around one rule: a note is not believed until it has been checked against its source. That verification step guards against the compounding errors you get when agents summarize their own summaries. It gives agents a store of notes with provenance rather than free-floating claims.

knowledge-baseverificationprovenancenotes
by mplind Aug 13, 2026 6/10
skill GitHub

competency-check: Diagnostic Skill for Finding Blind Spots in Adjacent Fields

competency-check is a diagnostic skill that probes what you do not know in professional areas next to your own. It surfaces blind spots rather than testing depth in your existing specialty. Useful for solo builders whose agent output now spans design, ops, and legal territory they never trained in.

skilldiagnosticlearningself-assessment
by wheeleny-design Aug 13, 2026 5/10
skill GitHub

mexican-mom: Skills That Make Your Agent Nag You Like a Traditional Mom

A skill pack that gives your agent the persona and habits of a traditional Mexican mother. It is a light take on persona skills, trading the usual neutral assistant tone for something with opinions. Worth a look mainly as a compact example of how far persona instructions can shift agent behavior.

personafunskilltone
by mcasillas17 Aug 13, 2026 5/10
skill GitHub

reSanity: A Zero-Dependency SKILL.md for Retail Investor Research Discipline

reSanity is a single-file Chinese-language skill that applies research discipline to retail investing decisions. It covers fact-checking claims, avoiding known traps, retaining what you learned, and reviewing past calls. One SKILL.md with zero dependencies, which makes it a clean example of packing a full workflow into one file.

skillchineseresearchzero-deps
by Thhoho Aug 13, 2026 5/10
skill Reddit

Audit skill that reports which checks Claude Code actually skipped

A single-file Claude Code plugin skill that audits the current change against an AUDIT_PROTOCOL.md and reports the tier it picked, the phases it ran, and the phases it skipped with reasons. Because it is just markdown it also works with Cursor, Codex, and other file-reading agents. The value is the explicit skipped-checks report rather than a silent pass.

auditcode-reviewpluginverification
by sturec5 Aug 13, 2026 7/10
skill GitHub

seudesign: Executable system design skill for Claude Code and Codex

Turns system design work into a runnable skill: design docs, architecture audits, capacity estimation, and mock interview drills. Works across Claude Code and Codex. Useful both for real architecture work and for interview prep.

system-designarchitecturecodexdocs
by SeuPut0705 Aug 13, 2026 6/10
skill GitHub

pm-evaluation-framework: 23 Claude Code skills for product managers

A library of frameworks, templates and rubrics wrapped as 23 Claude Code skills covering problem framing, value hypothesis, MVP scoping, prioritization, metrics, launch, PMF and AI integration. Aimed at daily PM workflows rather than one-off strategy documents.

product-managementtemplatesrubricsskills
by kalyvask Aug 13, 2026 6/10
skill GitHub

1c-quality-gate: Blocking quality gates for 1C:Enterprise development

A Claude Code plugin that enforces 1C:Enterprise (BSL) code standards — SOLID, design patterns, metadata XML rules — through blocking session gates. Produces a machine-readable evidence trail of what was checked. Very niche platform, but a solid template for domain-specific quality gating.

1cquality-gatestandardsplugin
by Romandredan Aug 13, 2026 5/10
skill GitHub

appllama-skills: Turn top-grossing app patterns into native-quality mobile screens

Agent skills that go beyond researching competitor apps and actually generate mobile screens following the UI patterns that top-grossing apps use. Framed as a builder rather than a research assistant. Useful starting point for mobile UI work driven by an agent.

mobileuidesignskills
by Appllama Aug 13, 2026 5/10
skill GitHub

LunarCommand/claude-skills: Query real traces and logs from your local stack

Claude Code skills for prod-local agent development: pull real traces and logs out of your local stack, plan before building, and review more deeply than a diff-scoped bot can. The observability angle is the differentiator — the agent reasons over actual runtime data instead of source alone.

observabilitytraceslogscode-review
by LunarCommand Aug 13, 2026 6/10
skill GitHub

superclarity: Make the agent clarify intent before it starts working

A general-purpose skill pack for long-horizon tasks: clarify what was actually asked, plan against the machine's real capabilities, and require evidence before claiming completion. Chinese-language documentation. Targets the ask-first, verify-after failure modes that bite on multi-hour tasks.

clarificationplanningverificationchinese
by haxudev Aug 13, 2026 5/10
skill GitHub

claude-skills-collection: 14 skills for a Chinese WeChat publishing pipeline

A complete pipeline from trending topic to published article for Chinese WeChat official accounts, packaged as 14 Claude Skills installable with two commands. Domain-specific, but a good example of chaining skills into one editorial workflow.

publishingwechatcontentchinese
by ma2ong Aug 13, 2026 5/10
skill Reddit

see-video: A skill that gives Claude Code real video frames, not the title

Extracts actual frames and captions so Claude answers from the video instead of guessing from the title. The clever part is frame selection: it reads your question first, scores moments against it using the transcript and on-screen text, then spends its frame budget there (5 of 55 candidates on one lecture). Downloads only the requested section, OCRs a larger copy locally, and transcribes with whisper.cpp — no API key.

videoffmpegwhispermultimodal
by krazybionic Aug 13, 2026 7/10
skill GitHub

what-are-the-bottlenecks: Find the real constraint in any system

A portable Agent Skill that identifies the actual limiting constraint in an idea, product, codebase, architecture, workflow or agent setup, rather than listing every possible improvement. Theory-of-constraints thinking packaged for agents. Works anywhere markdown skills work.

analysisconstraintsarchitectureportable
by Antonod1988 Aug 13, 2026 5/10
skill GitHub

docktor-compose: Read-only Docker Compose troubleshooting for agents

A CLI and Agent Skill for Codex and Claude Code that diagnoses exited, restarting and unhealthy containers plus ports, mounts, DNS, logs and OOM kills. Deliberately read-only, so the agent can investigate without changing your stack. Good pattern for giving agents diagnostic power without write access.

dockerdiagnosticsread-onlytroubleshooting
by bigu1 Aug 13, 2026 6/10
skill GitHub

claude-ad-skills: Seven read-only skills for Google and Meta ad accounts

Does senior media-buyer analysis on your ad accounts, working from either a connected account or a CSV export. Read-only by design, so it recommends rather than spends. Seven skills covering the usual optimization passes.

advertisingmarketingread-onlyanalytics
by riz1k9 Aug 13, 2026 6/10
skill GitHub

resume-tailor-skill: Tailor a resume to a job description, output a one-page .docx

A Claude Code skill that rewrites a resume against a specific job posting with recruiter-grade positioning and evidence scoring for each claim, producing a one-page .docx. Requires no code changes to use. Practical example of a document-producing skill.

resumedocxjob-searchwriting
by sakshi-gupta-1 Aug 13, 2026 5/10
skill GitHub

airshare: Publish HTML artifacts to a private, access-gated Cloudflare Pages site

One command to push reports, decks and dashboards to a private Cloudflare Pages site protected by Cloudflare Access. Ships as both a CLI and a Claude Code skill. Solves the awkward last step where an agent generates a nice HTML report and you need to share it with someone.

cloudflarepublishingartifactssharing
by hsongra11 Aug 13, 2026 6/10
skill GitHub

buyer-persona-builder: Research-backed personas from job posts and reviews

An AI research skill that synthesizes job postings, analyst reports, product docs, forums and reviews into buyer personas grounded in sources rather than invented. Compresses work that normally takes weeks into hours. Marketing-side use of an agent, but the source-synthesis pattern generalizes.

researchpersonasmarketingsynthesis
by LaureBrosseau Aug 13, 2026 5/10
skill GitHub

ds-vision-kit: Give text-only models vision through Claude Code skills

A generic vision core with pluggable scene skills — OCR, table-to-markdown, chart reading, UI review — so text-only models like DeepSeek and GLM can handle image tasks. A fork of Anionex/agent-vision-toolkit. Practical if you run a cheaper text-only model as your main driver.

visionocrdeepseekmultimodal
by awslew Aug 13, 2026 6/10
skill GitHub

claude-design-kit: Seven design skills plus two hooks that stop design drift

Design and build skills for Claude Code, paired with hooks that catch the slow drift away from your design system across a long session. MIT licensed with clear authorship and beginner-friendly docs. The anti-drift hooks are the differentiator over yet another design skill pack.

designhooksdesign-systemui
by emcquesten Aug 13, 2026 6/10
skill GitHub

ucsandman/claude-skills: 26 skills used daily on real projects

A working set rather than a demo collection: adversarial code review, shipping rituals, marketing asset pipelines, iPhone and desktop control, and multi-agent orchestration. The adversarial review and shipping-ritual skills are the ones worth reading first.

skillscode-revieworchestrationautomation
by ucsandman Aug 13, 2026 6/10
skill GitHub

claude-skill-writing-ecosystem: Orchestrator for human-facing writing and review

Coordinates article writing, editing, essay review and fact checking with an explicit AI-slop banned-word list in Japanese and English, voice rules, and title conventions. Role boundaries keep the editor from rewriting as the author. Designed to pair with an llms-txt writer for machine audiences.

writingeditingjapaneseorchestration
by shimo4228 Aug 13, 2026 5/10
skill GitHub

codex-review: A decorrelated second opinion on your diff from another model

A read-only Claude Code skill that wraps the OpenAI Codex CLI to review a diff, so the reviewer is a different model than the author. Cross-model review catches the blind spots a model shares with itself. Read-only, so it cannot quietly fix what it flags.

code-reviewcodexcross-modelread-only
by shimo4228 Aug 13, 2026 7/10
skill Reddit

Caveman rebuilt after JetBrains measured 8.5%, not 65%

JetBrains independently benchmarked the Caveman token-saving skill and found 8.5% output-token savings on long coding tasks, not the ~65% the author had been quoting from chat-style conversations. The author accepts the correction, notes JetBrains also found no quality loss, and rebuilds around the bigger source of waste the benchmark exposed. A rare public post-mortem on one's own numbers.

token-savingsbenchmarkoutput-stylepost-mortem
by VeryVexxy Aug 13, 2026 7/10
skill GitHub

web-app-security-skill: Scope, Audit, Harden and Retest With Evidence

An agent skill that runs a full web-app security cycle: define scope, audit for issues, apply hardening, then retest to confirm. Each pass leaves reproducible evidence so findings can be re-verified rather than taken on the agent's word.

securityauditwebskillhardening
by parousia8888 Aug 13, 2026 7/10
skill GitHub

gauntlet-loop: Bounded Worker-and-Critic Orchestration as a Skill

A portable Agent Skill implementing the worker/critic loop with an explicit bound, so review cycles terminate instead of spiraling. Portable across skill hosts, making it a drop-in way to add adversarial review to any task.

criticreview-looporchestrationskill
by kamtS Aug 13, 2026 7/10
skill GitHub

dev-skills-hub: Flat Skills Registry for Claude Code, Codex and Copilot

An extensible flat-file registry for sharing AI skills across Claude Code, OpenCode, Codex, and Copilot. Ships pre-configured with Magento 2 and Govard workflows, so it doubles as a working example of packaging domain-specific skills.

registryskillscross-agentmagento
by ddtcorex Aug 13, 2026 6/10
skill GitHub

agent-skills: Curated Collection of Reusable Agent Skills

A bilingual (EN/ZH) collection of agent skills packaged for reuse across projects. Useful mainly as a browsing source for skill patterns worth copying into your own setup.

skillscollectionchinesereusable
by manchan4869 Aug 13, 2026 5/10
skill GitHub

ShanireZskills: Skills for Competitive C++ and K-12 Teaching

A public Agent Skills marketplace focused on two niches: competitive-programming C++ style enforcement and K-12 teaching workflows. Narrow, but a concrete example of shipping domain skills as an installable marketplace.

skillsmarketplacecppeducation
by ShanireZ Aug 13, 2026 5/10
skill GitHub

korean-prose-skill: Korean Writing and Proofreading for Coding Agents

A skill that fixes awkward machine-translated Korean, targeting the unnatural 해요체 register that LLM output tends to produce. Useful for anyone shipping Korean-facing docs, UI copy, or commit messages written with an agent.

koreanwritingproofreadinglocalizationskill
by JellyBrick Aug 13, 2026 6/10
skill GitHub

speak-human-tw: Strip the AI Tells From Traditional Chinese Writing

A rewriting skill that detects 38 distinct AI writing tells in Traditional Chinese and rewrites them into natural prose, while correcting mainland-Chinese vocabulary and half-width punctuation. Works with Claude Code, Codex, and Cursor.

chinesewritingrewritinglocalizationskill
by Raymondhou0917 Aug 13, 2026 6/10
skill GitHub

deckmason: Production-Quality HTML Decks From Any Coding Agent

A presentation skill with 31 curated themes, automated color-theory validation, and Pyramid Principle storytelling structure, exporting to PPTX and PDF with brand import. Host-agnostic across Claude Code, Cursor, Codex CLI, and Windsurf.

slidespresentationhtmlpptxdesignskill
by a692570 Aug 13, 2026 8/10
skill GitHub

know-skills: Answers With Computational Social Science Rigor

A skill that routes questions by mode and depth and enforces truth-source discipline, so answers cite where they came from instead of confabulating. Backed by 48 offline contract tests, bilingual ZH/EN, works across Claude Code, Cursor, and Codex.

researchrigorcitationstestingskill
by Yuuqq Aug 13, 2026 6/10
skill GitHub

agy-companion: Delegate Code Review to Google Antigravity From Claude Code

Lets Claude Code shell out to Google's Antigravity CLI (agy) to review code or hand off tasks. A lightweight way to get a genuinely different model's opinion in-loop without leaving your Claude session.

antigravitycode-reviewdelegationcross-modelskill
by unlikelyzero Aug 13, 2026 7/10
skill GitHub

claude-skills: Open-Source Marketplace With agent-army and Continuation

A public Claude Code skills marketplace you add once, then install individual skills from — headliners include agent-army and claude-continuation. Hosted browsing available at claude-skills.amjad1233.com.

marketplaceskillsagent-armycontinuation
by amjad1233 Aug 13, 2026 6/10
skill GitHub

justin-figma-design: Inspect, Edit and Visually QA Figma Files

An agent skill for working directly against Figma files, including visual QA of the rendered result rather than just reading layer metadata. Host-agnostic across Agent Skills implementations; requires the Figma Console MCP.

figmadesignvisual-qamcpskill
by 1955m Aug 13, 2026 6/10
skill GitHub

e2e-skills: Generate, Audit and Debug Playwright and Cypress Tests

A testing toolkit that writes E2E specs from scratch, audits existing ones against 24 anti-patterns graded P0/P1/P2 with a focus on silent always-pass smells, and debugs flaky runs straight from playwright-report/ or cypress/reports/. The anti-pattern audit is the standout — agent-written E2E tests frequently pass without asserting anything.

e2eplaywrightcypresstestinganti-patternsflaky
by voidmatcha Aug 13, 2026 8/10
skill GitHub

collection-skill: Catalogs 150+ Scraping Tools, Then Picks One For You

Discovers and indexes over 150 scraping and collection tools on GitHub, then progressively narrows to the right one for your target and kicks off the crawl. Saves the usual half hour of comparing scrapers before any data gets collected.

scrapingcrawlingdiscoverytoolingskill
by Yuuqq Aug 13, 2026 6/10
skill GitHub

cargo-skills: GTM engineering skills for Claude Code via the Cargo CLI

A skill pack that turns Claude Code into a go-to-market engineering assistant. Covers lead list building, email finding and verification, waterfall enrichment, lead scoring, CRM sync, and buying-signal monitoring for job changes, funding, and tech intent. Backed by the Cargo CLI with 138 integrations and 50 data providers; also works with Codex and Cursor.

skillsgtmsalesenrichmentcrm
by getcargohq Aug 13, 2026 6/10
skill GitHub

dotbabel: Global Claude Code config and plugin for spec-driven development

A shareable global Claude Code configuration bundled with a portable harness plugin that enforces spec-driven development. Aims to keep agent work anchored to written specs and governance rules rather than ad-hoc prompting, and travels between machines and projects as one package.

configurationspec-drivenplugingovernanceclaude-md
by kaiohenricunha Aug 13, 2026 6/10
skill GitHub

tray-api-ai-plugin: Skills, Agents and Commands for 150+ Tray API Endpoints

An official plugin from Tray Tecnologia giving AI agents full integration with the Tray e-commerce platform APIs. It ships skills, agents, and slash commands covering more than 150 endpoints, so an agent can work the storefront API without you hand-writing request code. Documentation is in Portuguese; relevant mainly to Brazilian e-commerce developers.

pluginskillsapiecommercetray
by tray-tecnologia Aug 12, 2026 5/10
skill Reddit

Peter: A Skill That Turns Goals Into a Persistent JSONL Dependency Graph

An MIT-licensed Claude Code skill where a parent orchestrator decomposes a goal into a dependency graph persisted as JSONL, and backend and frontend agents implement scoped nodes with attached evidence and commits. Security and UI auditors are separate roles that cannot modify the code they judge. Loops stay inside nodes while the graph controls dependencies and handoffs, so a fresh agent can resume without reconstructing history.

skillorchestrationmulti-agentdependency-graphaudit
by BaXRS1988 Aug 12, 2026 7/10
skill GitHub

search-and-scale-os: A Job-Search Operating System Built as Skills

A set of Claude Code skills covering the full job-search lifecycle: sourcing roles, tailoring resumes, chasing referrals, interview prep, and offer negotiation. Everything runs locally with a human in the loop at each stage, and it is MIT licensed.

job-searchcareerskillshuman-in-the-loop
by guerrilla2799 Aug 12, 2026 6/10
skill GitHub

pm-chief-of-staff: A Personal Chief of Staff Skill for PMs

A Claude Code skill that acts as a chief of staff for product people, building a second brain that starts from a conversation and adapts to how you work. Documentation is in Portuguese.

product-managementsecond-brainportuguese
by pe-menezes Aug 12, 2026 5/10
skill GitHub

code-idea: Turn an Idea Into a Complete AGENTS.md Docs Set

Takes a plan or rough idea and produces an agent-ready documentation set: AGENTS.md plus linked architecture, decisions, roadmap, product, and design docs. It interviews you with grounded recommendations instead of filling a fixed template, and works with any AGENTS.md-compatible agent.

agents-mddocumentationplanningscaffolding
by melconcoast Aug 12, 2026 6/10
skill GitHub

malaysian-chinese-skill: Authentic Manglish Voice for AI Agents

An agent skill that produces authentic Malaysian Chinese voice, covering Manglish particles, Hokkien/Cantonese/Malay code-switching, and kopitiam cultural register. Useful for localized copy that generic models get wrong.

localizationwritingmalaysianvoice
by jotterhans Aug 12, 2026 5/10
skill GitHub

hci-paper-writing: Red-Team Your HCI Paper Before Reviewers Do

An open-source agent skill for HCI research writing that diagnoses whether a paper's contribution is real, traces each claim back to its supporting evidence, and red-teams the argument before peer reviewers get to it.

academicwritingresearchpeer-review
by RobbieRao Aug 12, 2026 6/10
skill GitHub

claude-anatomy: Decision Tree for What to Build in Claude Code

A decision tree for choosing between a skill, subagent, hook, MCP server, plugin, routine, web page, app — or nothing at all — plus the file skeleton for whichever piece the tree lands on. Documented in Spanish and English; not affiliated with Anthropic.

decision-treeskillshooksplugins
by Hainrixz Aug 12, 2026 7/10
skill GitHub

save-point: A 30-Second Comprehension Check After Every Merge

An agent skill that quizzes you on the code you just shipped, right after an AI-assisted merge. The premise is that the review step catches defects but nothing checks whether you actually understand what landed. Works with Claude Code, Codex, and Goose.

code-reviewlearningquizmerge
by thierrypdamiba Aug 12, 2026 7/10
skill GitHub

blind-ux-test: A Subagent That Uses Your App Cold to Find Friction

Hands a business system to an AI with no prior explanation and measures where a first-time user would get stuck. Ships as a single Claude Code subagent definition; documentation is in Japanese.

uxtestingsubagentusability
by kishii-py Aug 12, 2026 6/10
skill GitHub

find-files-with-everything: Fast Windows File Search for Agents

Gives coding agents fast file discovery on Windows by shelling out to the Voidtools Everything CLI instead of walking directories. Works with Claude Code, Codex, and other compatible agents.

windowssearchfilesperformance
by DerrickZeng33 Aug 12, 2026 6/10
skill GitHub

deep-research-cs: 8-Agent Pipeline for Survey-Grade Lit Reviews

A research skill for CS and AI papers that runs an eight-agent pipeline to produce survey-quality literature reviews complete with comparison and SOTA tables. Search is arXiv-first, every citation is verified individually, and output passes through seven quality gates.

researcharxivmulti-agentliterature-review
by Yang-Shihui Aug 12, 2026 7/10
skill GitHub

peitho: A Rhetoric-Based Skill for Prose That Holds a Reader

A Claude Code skill for writing openings and prose that keep a reader engaged, built on classical rhetoric plus research that contradicts a lot of conventional hook advice.

writingrhetoricprosecopywriting
by Pr1m4lc0d3 Aug 12, 2026 5/10
skill GitHub

superCMO-skills: End-to-End Marketing Campaign Skills for Agents

Open-source skills that let any agent produce complete marketing campaigns, including UGC video, ad video, and product photography. Works across Claude, Cursor, and other skill-compatible agents.

marketingvideougccampaigns
by SupercmoHQ Aug 12, 2026 5/10
skill GitHub

digital-marketing-pro: Marketing OS With Human Approval Gates

An open-source marketing system covering strategy, SEO, AEO/GEO, paid media, content, CRM, and analytics. Outputs are grounded in explicit brand context and gated behind human approval, with verifiability as a design goal.

marketingseoanalyticscrm
by indranilbanerjee Aug 12, 2026 5/10
skill GitHub

slopware-skills: Portable Skills Built on a Minimum Sufficient Work Kernel

A free collection of portable agent skills and plugins for Codex, Claude Code, and other Agent Skills clients. Centred on the MSW Kernel, which pushes agents toward the minimum sufficient work for a task rather than sprawling output.

skillsportablecodexplugins
by transcendr Aug 12, 2026 5/10
skill GitHub

compdf-skills: PDF Convert, Edit, Split, and Compare for Agents

Official ComPDF skills that give coding agents real PDF processing: conversion, editing, splitting, insertion, comparison, and compression. Compatible with Claude Code, Cursor, Copilot, OpenCode, and dozens of other agents.

pdfdocument-processingskillsconversion
by ComPDFKit Aug 12, 2026 6/10
skill GitHub

framia-skills: Storyboard-First Video Generation With Audit Gates

Agent skills for creating video with Framia, structured storyboard-first with model routing, editor assembly, local ffmpeg finishing, and audit gates between stages. A companion repo holds reproducible example videos.

videostoryboardffmpegmedia
by convergeai-labs Aug 12, 2026 5/10
skill GitHub

Yandu DECK: Turn an Article Into a Scrollable Presentation Site

A Claude Code skill that converts an article into an immersive one-screen-per-frame presentation page with page-flip or autoplay, in warm-dark or off-white themes. Chinese fonts are self-hosted and subsetted, with one-command publishing to Cloudflare Pages.

presentationwebcloudflare-pageschinese
by huiyonghkw Aug 12, 2026 5/10
skill GitHub

Three Korean Skills for PR Writing, Review, and Comprehension Debt

A trio of Claude Code skills aimed at team practice: writing PRs, issues, and commits your teammates will actually read; a procedure for reviewing a teammate's PR; and a check on how much AI-written code you don't yet understand.

koreanpull-requestcode-reviewwriting
by iceberggymnast Aug 12, 2026 5/10
skill GitHub

lucide-svg-skill: Generate Original Lucide-Style Icons With Metadata

An agent skill that produces original icons matching Lucide's visual style, emitting both the SVG and Lucide-format metadata JSON. Works with Claude Code, Codex, Cursor, Gemini CLI, and other Agent Skills tools.

iconssvglucidedesign
by S6U5 Aug 12, 2026 6/10
skill GitHub

engineering-skills: 33 SDLC Skills Under Shared Principles

A unified Claude Code plugin packing 33 skills spanning the whole SDLC — product, research, design, develop, tune, test, verify, ship, operate — with a shared set of engineering principles injected at session start so every skill inherits the same standards.

sdlcpluginengineeringskills
by int2t05 Aug 12, 2026 6/10
skill GitHub

brainrot: Mine Your Own Chat History Into a Lean Claude Rule Set

A self-audit toolkit that mines your Claude chat history for the corrections you've had to repeat and the approaches that worked, arbitrates the findings into a compact rule set, and keeps the resulting memory tidy rather than ever-growing.

memoryself-auditclaude-mdrules
by coltonbearden Aug 12, 2026 7/10
skill GitHub

ship-what-you-built: Domain, HTTPS, and Deploys for First-Timers

A free guide plus Claude Code skill that walks someone who has never deployed anything through getting their project online: a domain, HTTPS, a GitHub repo, and automatic deploys.

deploymenthttpsgithubbeginners
by jhammant Aug 12, 2026 6/10
skill GitHub

bg-text: Bulgarian Text Quality Skill for AI Assistants

A skill that raises the quality of Bulgarian text produced by AI assistants and editor workflows, targeting the specific errors models make in the language.

bulgarianwritinglocalizationtext-quality
by AcTePuKc Aug 12, 2026 5/10
skill Reddit

ISO 24495 Plain Language Plugin: Five Skills and an Advisory Hook

A Claude Code plugin keeping output in plain language per the ISO 24495 international standards. Five skills cover core rules, legal writing, technical writing, organisational rollout, and document design, with Claude picking the right one per task. An advisory hook audits every markdown file it writes and reports sentence length, paragraph density, and legalese counts in a single line.

plain-languageiso-24495writinghooks
by gazmagik Aug 12, 2026 7/10
skill GitHub

dq-skills: Ten Skills That Audit and Clean Data Quality in SQL

Ten Claude Code skills for data quality work against any SQL database: profiling, quality metrics, audit reporting, standardization, imputation, deduplication, and defect prevention.

data-qualitysqlprofilingdeduplication
by koprjaa Aug 12, 2026 7/10
skill GitHub

light-novel-writer: Full-Pipeline Japanese Light Novel Creation

Covers the whole light-novel production pipeline: project setup, ranking-based topic selection, teardown analysis of successful works, outlining and the crucial opening chapters, drafting, de-AI-ifying the prose, multi-perspective review, and foreshadowing and timeline tracking. Integrates with Syosetu, Kakuyomu, and other Japanese and Chinese publishing platforms.

writinglight-noveljapanesepublishing
by MSKmrc Aug 12, 2026 5/10
skill Reddit

whetstone 4.4.1: Fixing Skills That Load When They Shouldn't

A release note worth reading for the trigger-scoping lesson: adding C and C++ skills that both claimed **/*.h meant every C header edit force-loaded 24 KB of skill bodies, most of it irrelevant to the task. whetstone itself is a Claude Code plugin of 19 agents, 22 commands, and 32 skills pushing agents toward planning, verification, and review before editing.

pluginskillstriggersrelease-notes
by Ilia0001 Aug 12, 2026 6/10
skill GitHub

video-gen-demo-booth: Pick a Video Model With Evidence, Then Ship

Claude Code skills for running AI video generation demo activations: choose a generation model based on evidence rather than vibes, then build a booth experience people can actually operate.

videodemoevaluationskills
by thepandanlabs Aug 12, 2026 5/10
skill GitHub

realmanagement: A Negotiation and People-Management Advisor

A Claude Code advisor for communication, people management, sales, and negotiation, distilled from 275 principles and 1,019 recorded negotiations across 157 live classes in Vladimir Tarasov's social-technology tradition. Answers in Spanish.

managementnegotiationcommunicationspanish
by arturgaliev3099-ux Aug 12, 2026 5/10
skill GitHub

bluepencil: Edit AI-Sounding Drafts Into Human Prose, or Audit

An agent skill that rewrites AI-sounding drafts into human prose, or audits them and reports the problems without touching the text. It targets the tells that persist after ordinary prompt tuning.

writingeditingai-detectionprose
by chernistry Aug 12, 2026 6/10
skill GitHub

repo2skill: Turn Any Public GitHub Repo Into an Agent Skill

Converts any public GitHub repository into a repository-native Agent Skill for ChatGPT and Claude. Browser-first and free, with no AI API key required to do the conversion.

skillsgithubgenerationbrowser
by Hhhkarimi Aug 12, 2026 7/10
skill GitHub

ru-text: Russian Text Quality Scoring With 2,000+ Atoms

A Russian-language text quality skill covering neuroslop cleanup, typography, information style, editorial standards, UX writing, and business correspondence. Scores text on a 0-10 scale using more than 2,000 linguistic atoms.

russianwritingtext-qualityediting
by talkstream Aug 12, 2026 6/10
skill GitHub

pa-reviewer: Review Against Italian Public-Sector Guidelines

An agent skill reviewing Italian public administration codebases against national guidelines and CAD obligations, checking what the official validators cannot see. It explicitly does not issue formal compliance judgements.

italypublic-sectorcompliancecode-review
by engineering87 Aug 12, 2026 5/10
skill GitHub

masters-nudge: Six Engineering Lenses for Long-Running Sessions

Delivers one well-timed third-party nudge into a long-running Claude Code session, evaluated through six distinct engineering lenses — a check from outside the session's own reasoning.

reviewlong-sessionsengineeringnudge
by shihchengwei-lab Aug 12, 2026 6/10
skill GitHub

paper-writer-skill: IMRAD Workflows and Literature Matrices

A Claude Code skill for academic manuscript writing, covering IMRAD-structured workflows, literature matrices, and table and figure preparation, with tested utility scripts included.

academicimradwritingresearch
by kgraph57 Aug 12, 2026 6/10
skill GitHub

claude-skills (ohugonnot): Quality-Gated Delivery and Review

A battle-tested personal skill collection covering quality-gated feature delivery, senior-level review, issue and merge-request workflow, branch wrap-up, book distillation, context saving, human-sounding technical writing, and a learning mentor.

skillscode-reviewquality-gatesworkflow
by ohugonnot Aug 12, 2026 6/10
skill GitHub

document-design-system: Five Skills Over One Token Contract

A design system for documents — analytical reports, diagrams, charts, decks, and long-form specs — output as self-contained HTML. Five Claude Code skills share a single semantic token contract so everything they produce looks like one system.

documentsdesign-systemhtmlreports
by Avinava Aug 12, 2026 7/10
skill GitHub

heliograph-skill: Debug an Unreachable Machine Using Git

A free skill for debugging a machine you cannot log into, through an operator who cannot debug it — aimed at air-gapped, client-owned, and change-controlled estates. Git serves as the transport in both directions.

air-gappeddebugginggitoperations
by dbhq-uk Aug 12, 2026 7/10
skill GitHub

claude-webapp-security-skill: A 9-Phase Audit and Hardening Plan

A Claude Code skill running a nine-phase web application security audit and hardening program covering API, LLM, OAuth, database, supply chain, and detection concerns. Also includes a crawl-boundary policy for AI crawlers, AWS hardening guidance, and read-only audit scripts.

securityaudithardeningweb
by parousia8888 Aug 12, 2026 7/10
skill GitHub

build-card: Make Your Agent Show a Plan Before It Builds

A Claude Code skill that forces the agent to present a seven-part plan in plain English before writing any code. Released into the public domain.

planningtransparencypublic-domainskill
by CraniusMaximus Aug 12, 2026 6/10
skill GitHub

claude-skills-research: Paper Review, Bibliographies, HPC Runs

Claude Code skills for academic research support: paper review, bibliography verification, literature surveying, head-to-head paper comparison, and managing HPC experiment campaigns.

academicresearchbibliographyhpc
by chgagne Aug 12, 2026 6/10
skill GitHub

SuperMD: Composable Anti-Slop System Prompt for 92 Professional Fields

A pure-Markdown system prompt kit built to cut generic AI output. It composes a universal core with per-domain modules across 16 categories and 92 sub-fields, is bilingual EN/ID, and ships an eval harness to verify the prompts do what they claim. Worth a look if you maintain CLAUDE.md files for work outside software.

prompt-engineeringmarkdownanti-slopevalclaude-md
by TegarTheGreat Aug 12, 2026 7/10
skill GitHub

claude-code-config: Daily-Driver Settings, Hooks, Permissions, and Skills

A public dump of one engineer's working Claude Code configuration — settings.json, hooks, permission allowlists, plugins, and custom skills. The value is in seeing which permissions and hooks someone actually keeps after daily use, rather than a curated demo. Good starting point for tuning your own setup.

confighookspermissionssettingsdotfiles
by slogsdon Aug 12, 2026 6/10
skill GitHub

claude-plugins (jontsai): Plugins for Research, Productivity, and Dev Work

A personal but curated collection of Claude Code plugins grouped around research, productivity, and development workflows. Installable as a marketplace, so you can pull just the pieces you want. One of many such collections — skim it for the research-oriented plugins in particular.

pluginsmarketplaceresearchproductivity
by jontsai Aug 12, 2026 6/10
skill GitHub

lernkarten: Claude Code Skill Set for Print-Ready A4 Flashcards

A German-language skill set that turns arbitrary source material into printable study cards — A4 pages, 8 cards per sheet, laid out for duplex printing. Handles the layout details that usually make DIY flashcard generation annoying. Useful template even if you adapt it to another language.

skillflashcardslearningprintinggerman
by mhabedank Aug 12, 2026 6/10
skill GitHub

interview-sim: Timed Coding-Assessment Practice as an Agent Skill

An Agent Skill that runs GCA and ICA style coding assessments in your terminal with a deterministic timer and hidden-test grading. Questions are original rather than scraped from question banks. A neat demonstration of a skill that enforces constraints on you rather than helping you write code.

skillinterviewassessmentpracticeterminal
by chrisjacksonn Aug 12, 2026 7/10
skill GitHub

robotics-agent-skills: ROS1/ROS2 Skills for Production Robotics Code

Agent skills that push coding assistants toward production-grade robotics software, covering ROS1, ROS2, design patterns, SOLID principles, and testing. Written as SKILL.md files, so they work with Claude Code, Cursor, Copilot, or anything else that reads the format. Narrow domain, but robotics code is exactly where unguided agent output tends to go wrong.

skillroboticsrostestingdesign-patterns
by arpitg1304 Aug 12, 2026 7/10
skill Reddit

PlanX: Versioned, Foldable Plans You Will Actually Read

A planning skill and CLI built on the premise that most agent-generated plans are never read because they are an unreadable wall of text. PlanX splits plans into collapsible sections, versions them, diffs revisions while hiding unchanged parts, and lets you leave line-level feedback or edit directly before sending it back for another pass. Once approved, the plan can be executed by any agent.

planningskillclireviewversioning
by Yellow-Minion-0 Aug 12, 2026 8/10
skill GitHub

prompt-boost: Sharpen a Vague Request Into a Checkable Brief

A skill that intercepts loose requests and turns them into a structured brief before Claude Code starts working: goal, done-check, assumption, and scope fence. The done-check and scope fence are the useful parts — they give you something to verify the result against and a boundary the agent is told not to cross.

promptingscopingplanningbriefs
by sernoxxx Aug 11, 2026 6/10
skill GitHub

quant-llm-skills: 10 Quant Research Skills With 11 Reproducible Evals

Ten skills aimed at the failure modes that quietly ruin LLM-assisted quant research: lookahead bias, at-the-money detection, survivorship bias, and transaction-cost realism. Notably it ships 11 reproducible evals showing 8 of the skills measurably improve Haiku's output, which is more evidence than most skill collections offer. MIT, works with Claude Code and Cursor.

quantfinanceevalsresearch
by jefrnc Aug 11, 2026 7/10
skill GitHub

scrnaseq-skills-v2: Single-Cell RNA-Seq Analysis Skills for AI Agents

A knowledge framework for AI-assisted single-cell RNA-seq analysis, packaged as reusable computational workflows. Aimed at bioinformaticians who want an agent to follow established scRNA-seq practice rather than improvising an analysis pipeline.

bioinformaticsrna-seqresearchgenomics
by Ryannachmand Aug 11, 2026 5/10
skill GitHub

php-opcua/ai-skills: Auto-Synced SKILL.md for Every php-opcua Package

Agent skills for the php-opcua ecosystem, with a SKILL.md automatically kept in sync for each package in the family. Works across Claude Code, Laravel Boost, Cursor and Copilot. A reasonable pattern to copy if you maintain a multi-package library and want agent guidance to track releases.

phpopcuaskillsindustrial
by php-opcua Aug 11, 2026 5/10
skill GitHub

claudekit: Symlinkable Skills and CLAUDE.md Rule Snippets, No Build Step

A content-only collection of Claude Code skills — TypeScript audits, legal policy writing, SEO, agent memory — plus CLAUDE.md rule snippets. Nothing to compile: symlink a skill into .claude/skills and @-import the rule files into your own CLAUDE.md.

skillsclaude-mdtypescriptseo
by daanvandenbergh Aug 11, 2026 6/10
skill GitHub

aws-reinvent-planner: Conflict-Free re:Invent Schedules From Skills + CLI

Claude Code skills plus a zero-dependency CLI for planning an AWS re:Invent week. It scores sessions against your profile, builds conflict-free schedules that account for travel time between Las Vegas venues, and can produce team coverage plans so a group does not all attend the same talks.

awsconferenceplanningcli
by connor-tyndall Aug 11, 2026 6/10
skill GitHub

skill-vault: Organize, Secure and Search Your Claude Code Skills

A single vault for collecting Claude Code skills so they can be found and reused across projects instead of being scattered per repo. Adds organization and a security review step on top of plain file storage.

skillsorganizationreusesecurity
by Synchronic-leafbud824 Aug 11, 2026 5/10
skill GitHub

cami-design: UI Audit Skill That Routes Each Issue to the Right Owner

A Claude Code skill that audits your UI before you ship and, rather than dumping one flat list, classifies every finding as a layout, interaction, copy or engineering problem. The routing is the useful part: it turns a design review into work items that already belong to someone.

uidesign-reviewauditqa
by PawlakCamille Aug 11, 2026 7/10
skill GitHub

Foreman: Markdown-Only Build Playbook for Agent-Driven Website Builds

A playbook that makes your coding agent run a website build like a foreman: it interviews you, forces the design and scope decisions up front, locks a visual system, writes the build brief, then verifies, ships and indexes the site. Available as a Claude Code plugin and Agent Skill, and it is markdown only — no scripts to install or trust.

websitescopingdesign-systemplaybook
by Turki-Sh Aug 11, 2026 7/10
skill GitHub

sdlc-skills: Phase-Isolated SDLC Skills to Keep Agents on the Rails

A collection of SDLC skills deliberately isolated by phase, so an autonomous agent handles requirements, design, implementation and verification as separate disciplined steps rather than blurring them. The isolation is the mechanism — it prevents the agent from jumping to code while requirements are still open.

sdlcprocessengineeringphases
by augments-labs Aug 11, 2026 6/10
skill GitHub

ultimate-seo-geo: Audit, Plan and Execute SEO + AI-Search Optimization

A three-mode SEO and GEO skill — audit, plan, execute — covering full site audits with scored findings, optimization for Google AI Overviews, ChatGPT and Perplexity, schema generation and E-E-A-T assessment. Ships 20 diagnostic scripts, so the audit findings come from real checks rather than model opinion.

seogeoauditschema
by mykpono Aug 11, 2026 5/10
skill GitHub

anti-ai-slop-writing: Skill That Strips AI Tells From Prose

A Claude skill for writing human-sounding English, Russian, and Ukrainian, paired with a zero-dependency detector that flags common AI writing patterns. Useful if you draft docs, posts, or copy with Claude and want the output to stop reading like a model wrote it.

skillwritingmultilingualai-detection
by GitVoytenko Aug 11, 2026 6/10
skill GitHub

fullenrich-skills: SKILL.md Collection Usable as Skill, MCP, or Plugin

A published set of SKILL.md files from FullEnrich, packaged so the same definitions work as Claude skills, through MCP, or as a plugin. Worth a look mainly as a reference for how one team structures and distributes skills across all three delivery formats.

skillcollectionmcpplugin
by FullEnrich Aug 11, 2026 5/10
skill GitHub

cmdi-command-injection: Skill for Testing OS Command Injection

A Claude Code skill for security testing focused on OS command injection and argument injection. Packages the methodology so the agent probes for these specific classes systematically instead of relying on whatever it recalls about them.

skillsecuritycommand-injectiontestingappsec
by snowflakeovo Aug 11, 2026 7/10
skill GitHub

repocharter: One shared repo charter for Claude Code, Codex, and OpenCode

Generates a single charter file per repository that every coding agent reads, instead of maintaining separate CLAUDE.md, AGENTS.md, and tool-specific config. Aims for lean prompts plus guardrails that are actually verified rather than just stated. Useful if your team switches between agents or runs more than one against the same codebase.

claude-mdagents-mdcontextmulti-agentconfiguration
by 7fromheaven Aug 11, 2026 7/10
skill GitHub

agent-traffic-control: 61 skills for running parallel Claude Code sessions on one repo

A multi-skill plugin for the case where several CC sessions share a single repository. Covers an issue-pickup claim protocol so two agents do not grab the same work, worktree isolation pitfalls, recovering from conflicting parallel PRs, subagent integrity checks, and squash/merge mechanics. The most detailed treatment of parallel-session collisions posted so far.

parallel-sessionsworktreesgitskillsplugincoordination
by wan-huiyan Aug 11, 2026 8/10
skill GitHub

atlas-flight-booking-skill: Flight Search and Booking Skill for AI Agents

A skill that lets an agent search and book flights, auto-installing the atlas-flight CLI on first use. Demonstrates the pattern of a skill that bootstraps its own binary dependency. Niche, but a clean template for wrapping any CLI as a skill.

skilltravelclibooking
by atlas-doc Aug 11, 2026 5/10
skill GitHub

claude-scope-gate: Skills That Ask Whether a Change Is the Right Change

A set of Claude Code skills that interrogate the premise of a change before it gets built, rather than checking the code after. The argument is that code review, linters, and security scanners are all structurally downstream of the scoping decision. Sits at planning time, not review time.

skillscopeplanningreview
by Snowfly0709 Aug 11, 2026 7/10
skill GitHub

Claude-Skills: Agent Skills for Frontend, Secure Coding, Research, and Meta Ads

An open collection of Agent Skills spanning frontend engineering, secure coding practices, research, automation, and Meta Ads workflows. Follows the open Agent Skills standard so it works beyond Claude Code. Breadth over depth, but the secure-coding entries are worth a look.

skillsfrontendsecuritycollection
by sergeyizmailov Aug 11, 2026 5/10
skill GitHub

image-skills: AI Image Handoff and Deterministic Asset Processing

Open-source skills that separate the creative image-generation handoff from deterministic asset processing like resizing and format conversion. The deterministic half runs as real code rather than model output. Useful pattern for anything where you want the model to decide but not to compute.

skillimagesassetspipeline
by x0c Aug 11, 2026 5/10
skill GitHub

HMAP: Skill That Scores How Maintainable a Project Is for Humans

A Human Maintainability Assessment skill that evaluates whether a codebase remains workable by people, not just by agents. Produces a structured assessment rather than a lint report. Relevant as AI-generated code accumulates in projects humans still have to own.

skillmaintainabilitycode-qualityassessment
by hmr-BH Aug 11, 2026 5/10
skill GitHub

ai-daily-skill: Claude Code Skill That Builds a Daily AI News Digest

A skill that fetches, analyzes, and categorizes AI news on a daily schedule into a digest. Runs entirely through Claude Code rather than a separate service. Chinese-language documentation and output.

skillnewsautomationdigest
by geekjourneyx Aug 11, 2026 5/10
skill GitHub

BrotherModeUp: Skill for Plain-Language Planning and Verified Completion

A skill that reshapes Claude into a careful project partner: it plans in plain language, keeps durable state across sessions, and refuses to call work done without a passing check. Aimed at non-expert users who cannot easily audit the model's claims. The completion gate is the substantive part.

skillplanningverificationstate
by khalilmaaouni Aug 11, 2026 5/10
skill GitHub

jira-ticket-builder-skill: Rough Requirements Into Jira Stories and a Diagram Portal

Turns a loose requirements document into structured Jira stories alongside an HTML portal with architecture, UI flow, and customer journey diagrams. Runs as a Claude Skill or as ChatGPT custom instructions. The diagram portal is the differentiator over plain ticket generation.

skilljirarequirementsdiagrams
by kirti Aug 11, 2026 6/10
skill Reddit

EdgeResearch: Skills That Run Measured One-Change-at-a-Time Experiments

A skill set adapted from Karpathy's research repo that freezes the success metric, changes one thing, re-measures, then keeps or discards. Applied to prompts, copy, and configuration rather than model training. Guards against the common failure of agents shipping changes that quietly make things worse.

skillexperimentsevaluationresearch
by Free_Tennis7754 Aug 11, 2026 6/10
skill GitHub

Skillquiver: 23 Curated Agent Skills Installed as One Plugin

A bundle of 23 curated Agent Skills for Claude Code, installable as a single plugin instead of one-by-one. Once installed the skills are available across projects. Worth skimming for individual skills to lift even if you do not want the whole set.

skillsplugincollection
by Drizzy07x Aug 11, 2026 6/10
skill Reddit

ORC: Skill Constellation Running Intake, Plan, Subagents, and Verify

Not a runtime — markdown skills, slash commands, and model-pinned subagent definitions dropped into .claude/ that Claude Code reads as a disciplined pipeline: intake, analyze, plan, score, parallel subagents, review, verify, ship. The orchestrator never writes code itself; it scores each task 0-100 and routes accordingly. Installs via npm.

skillsorchestrationsubagentspipelineslash-commands
by JoR0th Aug 11, 2026 7/10
skill GitHub

idaibin/skills: Skills for Analysis, Planning, Review, and Runtime Verification

Independent Agent Skills covering repository analysis, planning, implementation, review, delivery, design, and runtime verification. Each is usable on its own rather than as a mandatory pipeline. Reasonable starting point for assembling a per-phase skill set.

skillsreviewverificationplanning
by idaibin Aug 11, 2026 5/10
skill GitHub

unit-cma-lite: Australian Apartment Comparative Market Analysis Skill

A Claude Code skill implementing buyer's-agent CMA methodology for Australian units and apartments using only free data sources. Open-sourced by Avocado Wealth. Domain-specific, but a solid example of encoding professional methodology into a skill.

skillreal-estateaustraliaanalysis
by mra2898 Aug 11, 2026 5/10
skill GitHub

mcp-server-skill: Skill for Building MCP Servers

A skill that guides Claude through building MCP servers, encoding protocol conventions and structure so you do not re-explain them each time. Minimal, focused scope. Useful if you write MCP servers regularly.

skillmcpdevelopment
by cyberreinxy Aug 11, 2026 5/10
skill GitHub

no-slop: Skill That Strips AI Slop From Writing and Interfaces

Checks writing and interface copy for the telltale patterns of AI-generated text, applies your own voice, then runs a final review pass. Includes safe update handling and an optional hook to run it automatically. Addresses the tone problem rather than the correctness problem.

skillwritingstylehook
by Rlegaspi562 Aug 11, 2026 6/10
skill GitHub

sichen-skills: Handoff, First-Principles, and Clarify-Until-Clear Skills

Three general-purpose skills validated on real projects: new-convo-handoff for carrying long projects across sessions, first-principles for reasoning from fundamentals, and clarify-until-clear for forcing disambiguation before work starts. Follows the open SKILL.md standard. Chinese-language documentation.

skillshandoffplanningclarification
by sichenai Aug 11, 2026 5/10
skill GitHub

claude-skill-unity-code-architecture: Architecture Standard for Unity and C#

A Claude Code skill encoding an architecture and code-quality standard for Unity and C# game code. Covers game programming patterns, Gang of Four patterns, code smells and refactorings, SOLID, and Unity-specific pitfalls. Substantial domain depth for a single skill.

skillunitycsharparchitecturegamedev
by alpershin Aug 11, 2026 6/10
skill GitHub

hey-codex: Skill That Calls the Codex CLI for a Second Opinion

A Claude Code skill that shells out to OpenAI's Codex CLI for a second opinion, to hand off a task, for analysis, or to generate an image. Makes cross-model consultation a single invocation instead of a manual context copy. Russian-language documentation.

skillcodexcross-modelsecond-opinion
by warodan Aug 11, 2026 6/10
skill Reddit

Tweed: Research-Mentor Guidelines for Reviewing Study Designs and Claims

An open-source framework that makes an AI behave like an experienced research mentor — clarify the question before picking methods, prefer established solutions, avoid unnecessary complexity, and check whether claims are actually supported by evidence. Can review ideas, study designs, manuscripts, references, and methodological choices. The author is explicitly asking for critical feedback.

skillresearchmethodologyreview
by Ashamed_Charity_7063 Aug 11, 2026 5/10
skill GitHub

claude-skills-nederlands: 121 Free Dutch-Language Agent Skills

A collection of 121 Dutch-language skills for Claude and any agent following the open Agent Skills standard. Published free by theseo.nl. Notable mainly for its scale and for serving a non-English audience.

skillsdutchcollectionlocalization
by GianlucaNaarden Aug 11, 2026 5/10
skill GitHub

syarif-laravel-ai-skills: Reusable Laravel Skills for Claude Code and Codex

A set of reusable Laravel-focused skills usable from Claude Code, Codex, and other AI coding assistants. Encodes framework conventions so they do not have to be re-explained per project. Straightforward but useful for Laravel shops.

skilllaravelphpframework
by soden46 Aug 11, 2026 5/10
skill GitHub

skills-gamedev: 22 Claude Skills for Unity, Unreal, Godot, and Roblox

Twenty-two skills aimed at game developers across Unity, Unreal, Godot, and Roblox, plus level design, narrative design, and shader authoring. Covers design disciplines and not only code. One of the broader domain-specific skill sets published so far.

skillsgamedevunityunrealgodot
by prvthmpcypher Aug 11, 2026 6/10
skill GitHub

subsquid-labs/skills: SQD's Official Agent Skills Collection

SQD's officially maintained collection of agent skills for working with their indexing platform. First-party, so it tracks the current API. Relevant for Web3 data indexing work.

skillsweb3officialindexing
by subsquid-labs Aug 11, 2026 5/10
skill GitHub

Paymob-AI-Integration-Skill: Official Payment Integration Skill for Claude Code

Paymob's official skill covering the Intention API, HMAC verification, mobile wallets, BNPL, and Apple Pay across Node.js, Python, PHP, Flutter, and more. Being first-party means the integration details stay current. A good example of a payment provider shipping agent-ready docs.

skillpaymentsofficialapiintegration
by PaymobAccept Aug 11, 2026 6/10
skill GitHub

agent-skills-collection: Curated Modular Skills for LLM Agents

A curated set of modular skills intended to be mixed and matched across LLM-based agents. Each skill is self-contained rather than part of a fixed pipeline. General-purpose collection.

skillscollectionmodular
by oliverb-io1902e8 Aug 11, 2026 5/10
skill GitHub

ai-video-generator-claude: 10 Skills for Studio-Quality AI Video Prompts

Ten Claude skills that generate structured video prompts for Seedance 2.0 on Higgsfield, spanning viral hooks, SaaS demos, personal brand, faceless content, and luxury aesthetic. Encodes prompt structure per format rather than leaving it freeform. Marketing-oriented rather than engineering-oriented.

skillsvideopromptscontentmarketing
by rediumvex Aug 11, 2026 5/10
skill GitHub

social-media-caption-generator-claude: Captions for Reels, TikTok, and Shorts

A skill that turns text, a script, or a screenshot into ready-to-post captions for Instagram Reels and Carousels, TikTok, Threads, Facebook, and YouTube Shorts. Tuned toward shares, saves, and completion rate per platform. Built by a creator with a large Instagram following.

skillsocial-mediacontentmarketing
by rediumvex Aug 11, 2026 5/10
skill GitHub

hormozi-sales-cold-outreach-claude: Offer Building and Cold Outreach Skills

Three skills encoding Alex Hormozi's frameworks: building offers, running a 0-to-$10M business playbook, and writing cold outreach. Turns a well-known business methodology into agent-callable steps. Business-oriented rather than technical.

skillsalesoutreachbusiness
by rediumvex Aug 11, 2026 5/10
skill GitHub

claude-codex-subagent: Run OpenAI Codex as a Subagent Inside Claude Code

A Claude Code skill plus watchdog runner that delegates tasks to OpenAI Codex (GPT models) as a subagent, with no background daemon required. Claude dispatches the work and the watchdog supervises the run and returns the result. Useful for cross-model second opinions or offloading work to a different model without leaving your session.

codexsubagentskillmulti-model
by caesay Aug 11, 2026 7/10
skill GitHub

claude-skills-czl: Drop-In CLAUDE.md Baselines, Skills, and Enforcement Hooks

An opinionated bundle of Claude Code configuration — CLAUDE.md baselines, skills, slash commands, and hooks that enforce the stated rules. It is meant to be copied into any project as a starting point rather than assembled piece by piece. A useful reference if you are standardizing setup across several repos.

claude-mdskillsslash-commandshooks
by Cristhianzl Aug 11, 2026 6/10
skill GitHub

ai-system-engineer-skill: Turn Messy AI Prototypes Into Structured Systems

An Agent Skill that applies systems-engineering discipline to prototype agent workflows, pushing them toward defined structure and explicit validation. It targets the stage where a working hack needs to become something maintainable. Installs as a skill rather than requiring a framework migration.

skillsystems-engineeringvalidationrefactoring
by Odinary-AI Aug 11, 2026 6/10
skill GitHub

cs-automation-skills: Eight Claude Code Skills for Customer Success

Eight Claude Code skills targeting enterprise customer success work: health scoring, QBR preparation, onboarding diagnostics, and punchout troubleshooting. A useful example of packaging non-engineering business processes as skills. Niche unless you work in enterprise CS.

skillscustomer-successenterpriseqbronboarding
by Prashanthvara Aug 10, 2026 5/10
skill GitHub

easy-prd-testing: PRD-Driven Automated Testing Skills with Execution Gates

A set of skills for Claude Code and Codex that drives automated testing from a PRD or prototype rather than from ad hoc prompts. Covers requirement clarification, test planning, execution gating, evidence collection, XMind mind maps, and regression runs. Documentation is in Chinese.

testingprdqaregressionchinese
by dszblackmagic Aug 10, 2026 6/10
skill Reddit

Opus 5 Resolves Contradicting CLAUDE.md Rules by Position, Not by Flagging

Report that when two instructions in CLAUDE.md conflict, Opus 5 silently commits to whichever appears later in the file and drops the earlier one, instead of wavering or raising the conflict. Older models tended to split the difference, which at least made the contradiction visible in the output. Practical takeaway: audit your instruction file for conflicts and put the rule you actually want lower in the file.

claude-mdopus-5instructionscontext-engineering
by cleverhoods Aug 10, 2026 7/10
skill GitHub

Helpful-Claude-Skills: Free Open Collection of Agent Skills for Claude

An open, freely licensed collection of Agent Skills that work in both Claude Code and Claude Desktop. Useful as a starting library if you want working skill examples to copy and adapt rather than authoring from scratch.

skillscollectionclaude-desktopopen-source
by jmadden Aug 10, 2026 6/10
skill GitHub

verifiable-agent-skills: 7 Skills to Stop AI Fabrication and Fake Completions

Seven methodology skills aimed at the failure modes where an agent invents data, reports work as done when it is not, or loses context when a session hands off. Each skill pushes the agent toward claims that can be verified and traced back to evidence. Bilingual Chinese and English documentation.

verificationhallucinationskillstraceabilitychinese
by billyzhou0-0 Aug 10, 2026 6/10
skill GitHub

htmldeck: Single-File HTML Decks via a 163-Rule Claude Code Design System

A Claude Code plugin that produces presentations as one self-contained .html file you can double-click and view with the network off. It enforces a 163-rule design system, runs a build check that names every rule it could not satisfy, and finishes with a deliberately blunt critique pass. Targets the problem of slides that visibly look machine-generated.

presentationshtmldesign-systempluginoffline
by uchimata2 Aug 10, 2026 7/10
skill GitHub

nestjs-hexagonal: Claude Code Plugin for DDD, CQRS, and Hexagonal NestJS

A Claude Code plugin for building NestJS bounded contexts using hexagonal architecture, DDD, CQRS, and event-driven patterns. Bundles 10 skills and 8 agents split across Opus and Sonnet, with a TDD workflow and GSD compatibility. Opinionated but concrete if you already work this way.

nestjsdddcqrshexagonaltddplugin
by Softtor Aug 10, 2026 6/10
skill GitHub

skill-email-html-mjml: Cross-Client HTML Email with MJML

A Claude Code skill that generates HTML email using MJML so the output survives real mail clients. Output is Outlook-safe, Gmail-optimized, and meets WCAG 2.1 AA accessibility. Removes most of the trial and error from hand-writing table-based email markup.

emailmjmlhtmlaccessibilityskill
by framix-team Aug 10, 2026 6/10
skill GitHub

personify: Revise Text to Keep Your Voice and Strip AI Writing Tells

A Claude skill that reviews and rewrites text to remove the stylistic tells of AI generation while preserving the author voice. Rather than a generic humanizer, it works from your existing writing as the reference point. Useful for anyone drafting with Claude but publishing under their own name.

writingstyleeditingskillvoice
by smartwatermelon Aug 10, 2026 7/10
skill GitHub

paperasse: AI Agent Skills for French Bureaucracy — Accountant, Notary

A collection of skills that give AI agents domain knowledge of French administrative processes, with specialized roles such as accountant and notary. Narrow in scope but a good template for how to package regional or regulatory expertise as agent skills. Documentation is in French.

skillsfrancebureaucracydomain-expertisefrench
by romainsimon Aug 10, 2026 5/10
skill Reddit

Slushpile: nine skills that model the applicant queue, not the job description

A plugin of nine Claude Code skills for job hunting that scores you against the other applicants in a req's queue rather than against the job description itself. An onboarding interview writes four files you keep (profile, preferences, stories, search state), and subsequent commands search job boards and tailor material against them. The argument is that a 91% JD match is a rejection if the queue's 75th percentile sits at 94%.

job-searchskillsresumeplugin
by aaddrick Aug 10, 2026 7/10
skill GitHub

handdrawn-ppt: turn one character image into hand-drawn presentation decks

A Claude skill that takes a single character illustration and produces a full hand-drawn-style deck around it, including research with cited sources plus charts, tables, and flow diagrams. Supports Korean and English.

slidesdesignkoreanresearch
by moongiadventures-dev Aug 10, 2026 5/10
skill GitHub

dream-skill: memory consolidation with snapshots and one-command rollback

Consolidates a project's accumulated agent memory in passes: a read-only 'dream' pass that only proposes, a checkbox and validator gate before anything is written, and a full-auto mode once you trust it. Every run snapshots first and rolls back with one command, and the tooling never calls rm.

memoryconsolidationsafetyrollback
by timoncool Aug 10, 2026 7/10
skill GitHub

klinko-content-strategy-builder: prioritize topics, formats, and channels

An agent skill for content strategy work: ranks the questions your audience actually asks, then maps them to topics, formats, channels, and where to invest. Business-side rather than engineering, but it is a real skill you can install.

content-strategymarketingplanning
by klinkoai Aug 10, 2026 5/10
skill GitHub

touchstone: build agent skills and prove they work with paired baseline evals

A toolkit for authoring agent skills for Claude Code, Codex, and OpenCode that pairs every skill with a baseline eval, so you can measure whether the skill actually changed behavior versus the model doing it anyway. That baseline comparison is the part most skill repos skip.

skillsevalstestingcodexopencode
by ecoma-io Aug 10, 2026 8/10
skill GitHub

mywholelife: self-managing long-term agent memory with a Claude Code boot skill

A persistent memory store plus a Claude Code skill that teaches the agent how to boot from it, recall relevant pieces, and consolidate new material at the end of a session. The skill half is what distinguishes it from a plain memory database.

memorypersistencecontext
by ChrisZhangJin Aug 10, 2026 6/10
skill GitHub

production-architecture-guardian: audits that never invent config numbers

A skill and subagent pair for production architecture work, auditing and designing for scalability, security, performance, and reliability. Its stated constraint is that it never fabricates a configuration number, which is the usual failure mode of architecture advice from LLMs.

architectureauditsubagentproduction
by dankofly Aug 10, 2026 6/10
skill GitHub

skill-tuner: verify a SKILL.md edit actually worked and still routes

Probes a SKILL.md, AGENTS.md, or CLAUDE.md to find out whether a change to it actually altered agent behavior, applies fixes that three independent skeptic passes agree on, and re-checks that the description still routes correctly. Treats agent-consumed documents as things you test, not things you hope about.

skillsevalsclaude-mdtesting
by StartupBros-com Aug 10, 2026 8/10
skill GitHub

handoff-prompt: compress a session into a handoff the next one can execute

Turns a finished agent session into a structured handoff document containing what was decided and what remains, so the next session can act without re-diagnosing the problem. A cheaper alternative to dragging a long transcript forward.

handoffcontextsessioncontinuity
by Xuepoo Aug 10, 2026 6/10
skill GitHub

i18n-guard: catch untranslated UI strings across 7 i18n stacks

A Claude Code skill that finds hardcoded UI strings that never made it into a translation catalog, and keeps catalogs in sync across seven different i18n frameworks. Exactly the tedious, mechanical check that agents are good at and humans skip.

i18ntranslationlintingfrontend
by omerfarukorc Aug 10, 2026 7/10
skill GitHub

reasonix_skill_repo: 12 self-contained skills from patent search to local OCR

Twelve independent agent skills covering patent search, document-to-skill conversion, web scraping, local OCR, project migration, Obsidian and OneNote note handling, remote deployment, and multi-machine sync. Each is self-contained, so you can take one without the rest.

skillsocrresearchobsidian
by Linearl Aug 10, 2026 6/10
skill GitHub

claude-skills-kit: 7 interconnected skills from prompt polishing to focus groups

Seven skills designed to work together: prompt polishing, an engineering workflow, web research, knowledge ingestion, an advisory board, and focus group simulation. The interconnection is the pitch, since output from one feeds naturally into the next.

skillsresearchpromptsworkflow
by Abed-Zahed Aug 10, 2026 6/10
skill GitHub

analyst-toolkit: BRD/NFR/ADR templates with skills that review against them

A requirements framework pairing BRD, NFR, and ADR templates with explicit quality rules, plus agent skills that both draft documents and review them against those rules. Templates and prompts are structured to stay in sync rather than drifting apart.

requirementstemplatesanalysisadr
by YuliaMelekhova Aug 10, 2026 6/10
skill GitHub

taste: learned coding preferences for Claude Code, stored as readable markdown

Captures your coding preferences from real signals during sessions and stores them as plain markdown you can read, edit, and delete, shared across a team over git. The readability and the delete path are what separate it from opaque memory systems.

preferencesmemorymarkdowngit
by toshon-jennings Aug 10, 2026 7/10
skill GitHub

Quant-Off skills: security audit marketplace for crypto and binary review

A Claude Code plugin marketplace of evidence-based security auditing skills, including constant-time crypto review, checks for whether mitigations survived compilation into the binary, and zero-trust codebase audits. Considerably more specialized than generic 'find vulnerabilities' skills.

securityauditcryptographymarketplace
by Quant-Off Aug 10, 2026 7/10
skill GitHub

authoring-kaltura-docs-skill: a Diátaxis documentation expert skill

An agent skill encoding Diátaxis documentation practice for Kaltura's docs, installable via Claude Code, GitHub Copilot, and Claude Desktop. Vendor-specific in its content, but a usable reference for how to encode a documentation framework as a skill.

documentationdiataxiswriting
by kaltura Aug 10, 2026 5/10
skill GitHub

saas-preflight: pre-ship audit for billing and data-isolation holes

A pre-ship audit skill for SaaS products that take money, targeting the billing and tenant data-isolation gaps that generic scanners miss on Next.js, Supabase, and Stripe stacks. Narrow stack focus is what lets it check things a general scanner cannot.

securitysaasstripesupabaseaudit
by Comoco235 Aug 10, 2026 7/10
skill GitHub

linkly-notes-skill: friction-free capture and verified recall for a personal KB

A note-taking skill for a personal knowledge base built around one-sentence capture, verified recall rather than hallucinated retrieval, and tags that grow out of your own notes instead of a fixed taxonomy. Bilingual Chinese and English.

notesknowledge-basememorychinese
by logog782-cmyk Aug 10, 2026 5/10
skill GitHub

prove-it: a claim taxonomy and protocol for catching false completions

Catalogs ten ways agents claim work is done when it is not, provides a taxonomy for classifying those claims, and defines a protocol for catching them before the change ships. Directly targets the most expensive agent failure mode.

verificationqualityprotocoltesting
by Nagacash Aug 10, 2026 7/10
skill GitHub

simplicio-sprint: read a Jira sprint, then verify it against repo architecture

A multi-agent skill that reads a sprint from Jira or Azure DevOps and then verifies the work against how the repository is actually structured, rather than taking the ticket description at face value. Works with Claude, Codex, Hermes, Openclaw, and Copilot.

jiraazure-devopssprintmulti-agent
by wesleysimplicio Aug 10, 2026 6/10
skill GitHub

research-bot: SDLC modernization skills for regulated environments

A Claude Code skill toolkit for teams modernizing SDLC under regulatory constraints, covering research digests, Copilot and GHAS governance, and an Obsidian-backed knowledge vault. Specific to regulated contexts, which most agent tooling ignores.

researchgovernanceobsidiancompliance
by themarmack Aug 10, 2026 5/10
skill GitHub

attention-span: ADHD-friendly output styles for Claude Code

Output styles that make agent responses easier to actually read: shorter, more human, structured for attention rather than completeness. Reduces token spend as a side effect of reducing verbosity.

output-stylesaccessibilityreadability
by alexgreensh Aug 10, 2026 6/10
skill GitHub

pm-tpm-skills: PRDs, roadmap prioritization, and build-vs-buy for PM/TPM work

A project-agnostic skill pack for product and technical program management: PRD generation, roadmap prioritization, build-versus-buy analysis, and TPM program mechanisms. Reusable across projects rather than tied to one codebase.

productprdroadmapprogram-management
by pavani-aiml-space Aug 10, 2026 5/10
skill GitHub

show-dont-tell: Claude Code Skill That Answers in ASCII Boards Instead of Prose

A Claude Code skill that reshapes responses into ASCII status boards, flow chains, and case matrices rather than long paragraphs. The goal is faster scanning of agent output when you want state and branching at a glance. A small, focused output-formatting skill.

skilloutput-formatasciireadability
by faridjaff Aug 10, 2026 6/10
skill GitHub

llm-sight-skill: PaddleOCR Wrapper Skill for Reading Image Text Without Vision

A Claude Code skill that wraps PaddleOCR so non-multimodal models can extract text from images. It fills the gap when you are running a text-only model but still need to read screenshots, scans, or diagrams. Documentation is bilingual (Chinese/English).

skillocrpaddleocrimagesvision
by BFRKQSB7 Aug 10, 2026 6/10
skill GitHub

ai-engineering-workflow-skills: Aggregated Canonical AI Engineering Skills

A curated aggregation of AI engineering workflow skills, collected into one installable repo. It serves as a starting pack for people who want established workflow patterns rather than authoring skills from scratch. Sourced from the maintainer's broader skills collection.

skillscollectionai-engineeringworkflow
by wakqasahmed Aug 10, 2026 5/10
skill GitHub

awesome-ai-agent-skills: 103 Complete SKILL.md Workflows, Not a Link List

A collection of 103 ready-to-use agent skills that ship as full SKILL.md workflows rather than pointers to other repos. The skills work across Claude Code, OpenAI Codex, Gemini CLI, Cursor, Copilot, Windsurf, and other Agent Skills-compatible tools. Useful as a browsable library when you want a working skill immediately.

skillscollectioncross-toolskill-md
by seb1n Aug 10, 2026 7/10
skill GitHub

writing-skills: Three-Step Rewrite Pipeline for AI-Drafted Prose

A set of Claude Code skills that rewrite AI-drafted prose through structural rewrite, tell removal, and cross-model diction passes, scored against the Pangram detector. It also includes reference management and citation auditing skills for research writing. Worth noting the detector-evasion framing is contentious in academic and publishing contexts.

skillswritingeditingcitationsprose
by petar-djukic Aug 10, 2026 5/10
skill GitHub

skills-vault-knowledge: Twenty Obsidian Knowledge-Work Skills for Claude Code

A set of twenty Claude Code skills for knowledge work in an Obsidian vault, including connect, contradict, emerge, trace, ghost, and weekly-learnings. They target synthesis over retrieval, surfacing contradictions and emergent themes across notes rather than just searching them. Useful if your notes live in Obsidian and you want an agent working the vault.

skillsobsidiannotesknowledge-worksynthesis
by slogsdon Aug 10, 2026 6/10
skill Reddit

Opus Pocus: Strip Legacy Prompt Incantations That Backfire on Opus 5

A plugin that removes instruction patterns written for weaker models, which the Claude 5 family now follows too literally: CRITICAL/YOU MUST shouting, verify-your-work charms, and Stop hooks that re-fire on unchanged state. The author's argument is that compensation written for an older model becomes a curse on a stronger one, producing death spirals and off-task behavior. Packaged so you can apply the cleanup to your own repo's memory files, hooks, and agent definitions.

pluginpromptingopus-5claude-mdhooks
by MickQn Aug 10, 2026 7/10
skill Reddit

graph-engineer: Automated Claude-to-Codex Write and Review Loop

A Claude Code skill that automates the manual copy-paste dance of writing with one model and reviewing with another. Claude drives the loop while Codex handles writing, review, and fixes. Requires the Codex plugin to be installed, and the author notes it is early-stage.

skillcodexreview-loopcross-model
by Ranteck Aug 10, 2026 6/10
skill GitHub

mastermind: Markdown Brain That Adds Judgment and Verification Discipline

An experimental markdown-based instruction layer for AI coding tools that pushes sharp defaults, explicit decisions, and verification before declaring work done. It targets Claude Code, Cursor, and Codex from one shared source, and is designed to refine itself over time as you use it. Flagged experimental by the author.

claude-mdpromptingcross-toolverification
by mehrad-dm Aug 10, 2026 5/10
skill GitHub

matrix-task: Requirements Matrices and Invariant Checks for Complex Tasks

An agent skill for Codex and Claude Code that decomposes complex coding work into a requirements matrix, then checks invariants and runs independent reviews before completion. The structure is meant to stop partial implementations from being reported as done. Works across both CLIs from the same skill definition.

skillrequirementsverificationreviewcodex
by JoeMarsh Aug 10, 2026 6/10
skill GitHub

indonesian-agent-skills: Compliance, Tax and Legal Domain Skills for Indonesia

A domain-intelligence skill pack for agents operating in the Indonesian business environment, covering compliance, tax, legal, and operational workflows. It is a useful example of encoding jurisdiction-specific knowledge into agent skills rather than relying on model recall. Niche by design, but a good template for other regions.

skillscompliancetaxlegalindonesia
by adamriofc Aug 10, 2026 5/10
skill Reddit

system-design-skill: arXiv-Backed System Design Before Claude Writes Code

An open-source Claude Code skill that forces a research pass before implementation: it searches arXiv for relevant papers, reads related work, and picks an architectural approach before any code is written. The author's argument is that agents default to building every service from scratch, which produces slow and fragile projects. Aimed at people who want design decisions grounded in prior art rather than improvised.

system-designarxivresearcharchitecture
by Uditakhourii Aug 9, 2026 6/10
skill GitHub

claude-code-power-pack: 12 Slash Commands, 4 Subagents, 3 CLAUDE.md Templates

A starter pack bundling twelve slash commands, four subagent definitions, and three CLAUDE.md templates aimed at real engineering workflows rather than demos. Good pick if you want a working baseline configuration to adapt rather than assembling one command at a time.

slash-commandssubagentsclaude-mdtemplates
by dacode-dev Aug 9, 2026 6/10
skill GitHub

agent-skills: Cross-Platform Skills for Codex and Claude Code

A skill and plugin distribution designed to install cleanly on both OpenAI Codex and Claude Code from one source. Useful if you switch harnesses and do not want to maintain two divergent copies of the same skills.

skillscross-platformcodexplugins
by ValentinNikolaev Aug 9, 2026 5/10
skill GitHub

graph-engineering (HM-Li): Design Multi-Agent Work as Dependency Graphs

A Claude Code skill for laying out multi-agent work as a dependency graph rather than a linear pipeline, so independent branches can run concurrently and only genuine dependencies serialize. One of several projects converging on graph engineering as a term.

multi-agentgraphorchestrationparallelism
by HM-Li Aug 9, 2026 7/10
skill GitHub

khazix-skills: Open-Source Agent Skills for Claude Code and 40+ Agents

A Chinese-language open-source skill collection covering goal definition (leader), code tidiness (neat-freak), analysis, and writing. Packaged to work across Claude Code, Codex, and a broad set of other agents.

skillscollectionchinesecross-platform
by KKKKhazix Aug 9, 2026 5/10
skill GitHub

Marginalia: A Claude Skill for PaperMC Plugin Development

A Claude Code skill and guided pathway for developing PaperMC (Minecraft server) plugins. Narrow domain, but the kind of API-specific grounding that stops an agent inventing method signatures.

minecraftpapermcplugin-devskill
by Y2Kwastaken Aug 9, 2026 5/10
skill GitHub

award-craft: Six Claude Code Skills for Awwwards-Level Landing Pages

A Claude Code plugin bundling six skills aimed at producing landing pages at the visual quality bar of Awwwards submissions. For people who find agent-generated marketing pages competent but generic.

designlanding-pagesfrontendplugin
by alanvaa06 Aug 9, 2026 6/10
skill GitHub

ship-it: Catch Forgotten UX and Product Details Before You Ship a Screen

A Claude Code skill that reviews a screen or feature for the product and UX details people routinely forget — empty states, error paths, loading, edge cases — before it ships. A checklist pass that costs one prompt.

uxreviewchecklistproduct
by LunkiBR Aug 9, 2026 6/10
skill GitHub

australian-accounting-skills: BAS, FBT, Division 7A and Month-End Close

Agent skills for Australian public-practice accounting covering BAS, FBT, Division 7A, Single Touch Payroll, month-end close, and workpapers. A clear example of encoding jurisdiction-specific professional rules as skills rather than trusting the model's recall.

accountingaustraliacomplianceskills
by ryanduguid Aug 9, 2026 5/10
skill GitHub

superpowers-safe: obra/superpowers With Five Mandatory Safety Gates

A safety-hardened fork of the widely used obra/superpowers skill library, keeping the same skills but adding a mandatory preflight with five hard gates before any skill runs. Defends the machine, hardware, budget, and data — relevant given how much superpowers can do unattended.

superpowerssafetygatesfork
by JFWaskin Aug 9, 2026 7/10
skill GitHub

advise-project-approach: Research Comparable Projects Before Advising

A Claude and Codex skill that forces an agent to research comparable projects, tradeoffs, costs, and failure conditions before it recommends how to build something. Counters the tendency to answer architecture questions from priors alone.

researcharchitectureadviceskill
by AaravKashyap12 Aug 9, 2026 6/10
skill GitHub

osint-verifier: Admiralty-Graded Source Verification Subagent for Claude Code

A free OSINT source-verification subagent written by a former intelligence analyst: it grades every source with the Admiralty system, flags single-source and uncited claims, catches circular reporting, and returns a calibrated verification note. Applies well beyond OSINT to any research an agent does.

osintverificationresearchsubagent
by beeswaxpat Aug 9, 2026 7/10
skill GitHub

mobile-adapt-skill: Audit and Adapt Web Apps for Mobile Devices

A skill that audits a web application for mobile issues and applies the adaptations. Narrow and practical for the common case of a desktop-first build that needs to work on phones.

mobileresponsiveauditfrontend
by lovstudio Aug 9, 2026 5/10
skill GitHub

install-tanstack-query-skill: Install and Configure TanStack Query

A single-purpose skill that installs and configures TanStack Query in a React project. The value of skills like this is getting current, correct setup rather than whatever version the model remembers.

reacttanstack-querysetupskill
by lovstudio Aug 9, 2026 5/10
skill GitHub

multi-model-routing-skill: Route Grunt Work to Local LLMs and Codex

A Claude Code and Cowork skill that routes batch and grunt work to local LLMs via Ollama or LM Studio, to Codex CLI, or to Claude subagents, keeping your quota for work that needs it. Routing is per-task rather than per-session.

routingollamalocal-llmquota
by scottconverse Aug 9, 2026 6/10
skill GitHub

superpowers-zh-tw: Full Traditional Chinese Translation of Superpowers

A complete Traditional Chinese translation of obra/superpowers — fourteen coding-agent skills — published with a GitHub Pages site offering paragraph-by-paragraph bilingual reading. Useful both as a translation and as a way to study the originals closely.

superpowerstranslationchineseskills
by shumingyang-opencode Aug 9, 2026 5/10
skill GitHub

cf-scraper: Web Scraping via Cloudflare Browser Rendering, No Infra

A Claude skill for web scraping and page analysis through the Cloudflare Browser Rendering API, returning rendered HTML, screenshots, PDFs, Markdown, structured data, and crawls. No browser infrastructure to run yourself.

scrapingcloudflarebrowserskill
by TempoRoyale Aug 9, 2026 6/10
skill GitHub

wix-to-astro: Migrate a Wix Site to Astro on Cloudflare With an Agent

A Claude skill and playbook for migrating a full Wix site to Astro on Cloudflare Workers, aiming for pixel-faithful output with measured results and stronger SEO than the original. Specific enough to be genuinely reusable if you have that migration ahead of you.

migrationastrowixcloudflare
by marian-kamenistak Aug 9, 2026 6/10
skill GitHub

craft-prompt-forge: Forge a Vague Idea Into a Craft-Grade Build Prompt

A bilingual Claude skill that turns a rough one-sentence idea into a detailed build prompt intended to get near-finished quality on the first attempt. Front-loads the specification work you would otherwise do through several rounds of correction.

promptingspecificationskillchinese
by dittowang Aug 9, 2026 6/10
skill Reddit

backend-setup-wizard: Provision Real Backends via CLI, No Placeholder Keys

An Agent Skill in the open SKILL.md format that provisions real backend services — Stripe, Postgres and similar — via their CLIs instead of hallucinating commands or quietly setting up a sandbox and calling it done. It asks for existing credentials first, looks up current official docs with the actual date, writes secrets only to .env, checks or creates .gitignore, and never prints keys back to the terminal.

backendprovisioningsecretsskill
by MonitorFlat4465 Aug 9, 2026 7/10
skill GitHub

art-direction-skill: Derive a Visual Concept, Then Audit the Build Against It

A Claude Code skill for interfaces with a visual identity of their own: derive the concept from the subject matter, write it to disk as an artifact, then audit the built UI against it. Writing the concept down first is what makes the audit step meaningful.

designart-directionuiaudit
by audient-id4 Aug 9, 2026 6/10
skill GitHub

traceknot: ISTQB-Aligned, Auditable QA Verdicts for Coding Agents

Makes coding-agent QA auditable with an ISTQB-aligned skill, traceable evidence, and deterministic verdicts, working across Codex, Claude Code, OpenCode, and other harnesses. The ISTQB grounding gives the verdicts a standard to point at in a regulated setting.

qatestingistqbaudit
by Jin-Doh Aug 9, 2026 6/10
skill GitHub

slide-forge: Generate Google Slides Decks With Offline Layout Checks

A Japanese-language Claude Code plugin for generating diagram-heavy Google Slides decks that inspects coordinates offline before generation, catching overflow, overlap, text spill, and disconnected connectors without calling the API. The offline check is the clever part — layout bugs get caught before you burn API calls.

slidesgoogle-slideslayoutjapanese
by wfukatsu Aug 9, 2026 6/10
skill GitHub

sovereign-ui: Build, Review, and Repair Production UI With Design Judgement

A Claude Code skill for product design engineering that builds, redesigns, reviews, and repairs production UI with actual design judgement, adapting to your codebase rather than imposing a template. Covers web, Android, Apple, desktop, and cross-platform targets.

uidesignfrontendcross-platform
by aliimrankhan86 Aug 9, 2026 7/10
skill GitHub

adversarial-review: Multi-Model Review With a Computed Release Verdict

A portable agent skill running multi-model adversarial code review and producing a deterministic, machine-computed release verdict rather than a prose opinion. Works with Claude Code, OpenAI Codex, and any SKILL.md-compatible platform.

code-reviewmulti-modeladversarialrelease
by SathiaAI Aug 9, 2026 7/10
skill GitHub

oceneni-nemovitosti: Czech Property Valuation and Negotiation Skill

A free Czech-language Claude Code skill for property valuation and price negotiation: three valuation methods, a guide to the land registry, and a negotiation playbook. A good example of local, jurisdiction-specific domain knowledge packaged as a skill.

real-estatevaluationczechskill
by konecny-lukas Aug 9, 2026 5/10
skill GitHub

apple-bento-grid: Apple-Style Bento Grid Cards as Self-Contained HTML

Generates Apple-style bento grid cards as self-contained HTML files, built for AI coding agents to produce pixel-accurate output with no design tools involved. Narrow but effective for a layout pattern models routinely get slightly wrong.

designhtmlbento-gridlayout
by NxProxyStudios Aug 9, 2026 5/10
skill GitHub

ai-media-generator: Director-Grade Prompts Across 14+ Generative Platforms

A Claude Code skill for crafting high-quality AI image, video, and music prompts and executing them through the browser across more than fourteen generative platforms. Packages director-level prompt craft so you do not need it yourself.

mediapromptingvideoimage-generation
by Hao0321 Aug 9, 2026 5/10
skill Reddit

Greenbatch: Run Each Dependency Update Through Your Gates, Then One PR

A skill that tests each dependency update individually against your CI gates and then opens a single consolidated PR. Written out of frustration with Dependabot opening several PRs a week, each triggering a full pipeline run and, with continuous deployment, a separate deploy. The per-update testing is what keeps the single PR trustworthy.

dependenciescipull-requestsautomation
by Anaq42 Aug 9, 2026 7/10
skill GitHub

open-visualization-protocol: 74 Chart Skills Across 16 Design Languages

An open protocol for describing, validating, and rendering information design identically for humans, software, and AI agents on any platform, with 74 chart skills across 16 design languages. Ambitious in scope; the validation step is what would make agent-generated charts consistent.

visualizationchartsprotocoldesign
by babarda Aug 9, 2026 6/10
skill GitHub

mac-to-windows-testing-skill: Build and Test Windows Apps From a Mac

Lets an AI running on a Mac build, operate, inspect, repair, and retest desktop applications on a real Windows PC. Solves a genuine cross-platform gap where the agent otherwise cannot see the target environment at all.

windowsmacostestingcross-platform
by wimi321 Aug 9, 2026 6/10
skill GitHub

genesis-architect: Mine GitHub Issues for Failures Before Scaffolding

Research-first project scaffolding for Claude Code that mines GitHub Issues for real production failures in comparable projects before writing a single file. Grounds early architecture decisions in what actually broke for other people.

scaffoldingresearchgithub-issuesarchitecture
by maioio Aug 9, 2026 7/10
skill GitHub

claude-skills-vetted: Curated Claude Skills That Were Read and Tested

A curated skill list where each entry is read in full, trimmed of Claude Code-only dependencies, checked against claude.ai's upload requirements, and labeled by where it actually works, with ready-to-download zips. The vetting is the value — most skill lists are link dumps.

skillscurationvettedclaude-ai
by Zephyrex21 Aug 9, 2026 6/10
skill Reddit

pi-research: A Web Research Skill Built Around Injection Risk and Sourcing

An agent skill for web research and knowledge lookup, alongside a writeup on why default agent browsing is both risky and inefficient. Covers prompt injection from hostile pages — the example given is a site whose robots page instructs agents to delete things — and argues for a dedicated research path over ad-hoc fetching. Originally built for the Pi coding agent, now used mainly in Claude.

researchwebprompt-injectionsecurity
by JaspreD Aug 9, 2026 6/10
skill Reddit

security-hardening-wizard: A Security Audit Skill That Applies the Fix

Scans every file in a project — not just source, since secrets and misconfiguration show up in READMEs, CI YAML, Dockerfiles, and old notes — using real scanners like gitleaks, npm audit, and pip-audit plus manual review for injection risks, weak CORS, and missing auth. It then applies the fix directly in code rather than filing a report. Honest about the case it cannot fix: a secret already exposed in git history.

securityauditsecretsremediation
by MonitorFlat4465 Aug 9, 2026 7/10
skill GitHub

tutorial-creator: Generate Personalized Coding Lessons From Your Codebase

A Claude Code skill that generates coding lessons from your own repository across three surfaces (tutorial, vocabulary, status), with six writing-to-learn entries and six venue templates for audience-facing output. Useful for onboarding people onto an unfamiliar codebase.

learningonboardingdocumentationskill
by Terryc21 Aug 9, 2026 6/10
skill Reddit

Proven-Viral-Content-System: A Skill That Generates Meme and UGC Promos

A free skill that interviews you about your product, target audience, and competitors, then suggests and generates viral content ideas for posting across socials. The author reports 10M+ views, 80k visits, and 500+ signups in a week at roughly $0.40 per video — self-reported numbers worth treating as such.

marketingcontentugcgrowth
by swaroopmehetar Aug 9, 2026 5/10
skill GitHub

decision-ledger: Three Skills That Record Decisions You Could Defend

Three Claude Code agent skills that capture which structural decisions you could actually defend and hand them back as a map of your project. Filters for defensible decisions rather than logging everything indiscriminately.

decisionsarchitecturedocumentationskills
by Dupflo Aug 9, 2026 6/10
skill GitHub

groundschool-skill: Turn a Repo Into a Course With Exams and Code Anchors

A Claude Code skill that reads a repository and writes a course about it: tracks, checklists, flash decks, exams, and code anchors that open your editor at the relevant line, presented as a local-first dashboard that remembers your progress.

learningonboardingdashboardskill
by brickster241 Aug 9, 2026 6/10
skill GitHub

reactbits.dev-skill: Fetch Real React Bits Source From the Live Registry

A Claude Code skill that pulls actual React Bits component source from the live registry rather than reconstructing it from model memory. The same pattern — fetch, do not recall — applies to any fast-moving component library.

reactcomponentsregistryskill
by Philotheephilix Aug 9, 2026 6/10
skill GitHub

get-cited-by-ai: Skill for Getting Cited by AI Search Engines

A Claude Code skill implementing a demand-gated GEO (generative engine optimization) workflow. Every rule in it is evidence-tagged against a corpus of 26,767 measured citations, so recommendations trace back to observed data rather than SEO folklore.

seogeocontentskill
by paultaki Aug 8, 2026 7/10
skill GitHub

ai-market-research-skills: Six Evidence-Led Market Research Skills

Six skills covering audience discovery, market validation, positioning and content strategy, each structured to work from evidence rather than assertion. Works in both Claude Code and Codex.

market-researchskillspositioningcontent-strategy
by klinkoai Aug 8, 2026 6/10
skill GitHub

Ai-Stack: Daily-Driver Agent Skills Installable With npx skills add

A collection of the agent skills an engineer reaches for day to day, packaged so each installs with a single 'npx skills add' command. Low-ceremony way to pick up individual skills without cloning a whole repo.

skillscollectionnpx
by nazmulnahid-git Aug 8, 2026 5/10
skill GitHub

temper-skills: Test Suites for Your Agent Skills' Decision Logic

Adversarial persona reviewers write test suites against a skill's decision logic, then deterministic Python is generated that must keep passing them - with zero LLM calls at inference time. Try it with 'uvx temper-skills audit <skill.md>'. A rare attempt to make skill behavior verifiable instead of vibes-checked.

testingskillsdeterminismaudit
by CyrilLeMat Aug 8, 2026 8/10
skill GitHub

catalyst-search-skill: Bilingual Catalysis Literature Search for Agents

A bilingual (English/Chinese) skill for searching catalysis literature, usable from Claude Code, OpenClaw, Hermes, Cursor and WorkBuddy. Narrow domain, but a clean example of packaging a research search workflow as a portable skill.

researchchemistryliteraturebilingual
by ANDYPENG09 Aug 8, 2026 5/10
skill GitHub

deep-structural-analysis-skill: 16-Lens Toolkit for Complex Questions

A multi-disciplinary analysis skill for social, economic, philosophical and systemic questions: 16 lenses, 10 structural tools and an attack-loop protocol that deliberately assaults the analysis's own priors. Bilingual and MIT licensed.

analysisreasoningbilingualskill
by tetckx Aug 8, 2026 5/10
skill GitHub

pinescript-plugin: Pine Script v6 Skills and MCP With a Real Validator

Pine Script v6 skills plus MCP tooling for coding agents, backed by an actual validator rather than prose guidance - generated scripts get checked instead of assumed correct. Aimed at TradingView indicator and strategy work.

pinescripttradingmcpvalidation
by jpantsjoha Aug 8, 2026 6/10
skill GitHub

bioinformatics-agent-skills: Genomics, Drug Discovery and Multi-Omics

A large open collection of scientific agent skills, tool specifications and prompt protocols for bioinformatics, genomics, drug discovery and multi-omics work. Compatible with Cursor, Claude Code, Antigravity and LangChain.

bioinformaticsgenomicsscienceskills
by YuliaNuzhnenko Aug 8, 2026 6/10
skill GitHub

biomedical-ai-skills: Agent Skills for Cancer Biology and Multi-Omics

A focused set of agent skills for cancer biology and multi-omics research, covering the analysis steps a lab actually repeats. Narrower than the general bioinformatics collections and correspondingly more opinionated.

biomedicalcancermulti-omicsskills
by zamushwani Aug 8, 2026 5/10
skill GitHub

ai-skills: Native CLI for Installing and Syncing Agent Skills

A native CLI for managing reusable prompt skills across AI coding agents, with install, list, read, update, sync and remove commands working over both project-local and global skill directories.

cliskillspackage-manager
by kevin-lee Aug 8, 2026 6/10
skill GitHub

codebase-cleanup: Three-Phase Dead Code and Module Consolidation Skill

A Portuguese-language Claude Code skill that cleans a codebase in three phases - removing dead code, consolidating shallow modules and reorganizing folders - with atomic commits per step and a test gate between phases.

refactoringcleanupskillportuguese
by CRangelP Aug 8, 2026 6/10
skill GitHub

biodiscovery-skills: Thinking Tools for Life-Science Discovery

Skills framed as thinking tools rather than task runners, for agents helping make discoveries in the life sciences. Focused on how to reason about a research question, not just how to run the pipeline.

sciencediscoveryskillsresearch
by dekan-aleksandr Aug 8, 2026 5/10
skill GitHub

superpowersplus: Spec-Driven Development Where Claims Cite file:line

A Superpowers-derived (MIT) spec-driven workflow with one hard rule: every claim the agent makes carries a file:line citation, and verifier steps re-run the search to confirm it. Pitched at non-programmers as well as developers.

spec-drivenverificationcitationsskills
by rodrigopaitach Aug 8, 2026 7/10
skill GitHub

databricks-agent: 17 Skills Over Unity Catalog, DLT and Spark SQL

The Databricks adapter for a platform-portable analytics delivery doctrine: 17 Claude Code skills plus a CLI covering Unity Catalog, DLT and Spark SQL. Sibling project to powerbi-agent.

databricksdata-engineeringskillssql
by santoshkanthety Aug 8, 2026 6/10
skill GitHub

powerbi-agent: 45 Skills for TOM, TMDL, PBIR and Fabric REST

The Power BI adapter for the same portable analytics doctrine: 45 Claude Code skills plus a CLI over TOM, TMDL, PBIR and the Fabric REST API, drawn from 20+ years of regulated, high-volume BI delivery.

powerbibiskillsfabric
by santoshkanthety Aug 8, 2026 6/10
skill GitHub

britcheck: Skill That Scores Whether AI Images Actually Look British

A small Claude Code skill that rates AI-generated images on how convincingly British they look, taking the minimum of two scores and shipping at 8 or above. Silly domain, but a tidy pattern for min-of-two-judges scoring gates.

image-evalscoringskillfun
by Theo7777 Aug 8, 2026 5/10
skill Reddit

Do You Write Your CLAUDE.md Yourself? This Author Doesn't

Amid the wave of Opus 5 complaints, the author reports no quality drop at all and suspects the difference lies in how project instructions are written. Their approach: don't hand-author CLAUDE.md - have the model produce and maintain it. A useful counterpoint on where perceived model regressions actually come from.

claude-mdconfigurationdiscussion
by minaminonoeru Aug 8, 2026 6/10
skill GitHub

bestdeejay/agent-skills: Skill Collection With Manifests and CI Checks

A skill collection covering github-repo-hygiene, test-graphics, reddit-karma, presentation-maker and docs-system, each shipped with a skill.json manifest, CI validation and full documentation rather than a bare markdown file.

skillscollectioncimanifests
by bestdeejay-design Aug 8, 2026 5/10
skill GitHub

ecom-a11y-audit: WCAG 2.2 AA Audits for Shopify Stores

An agent skill that scans a Shopify store for WCAG 2.2 AA issues, attributes each finding to the theme or to an installed app, and prioritizes the fixes. The theme-vs-app attribution is the part generic accessibility scanners miss.

accessibilityshopifywcagaudit
by kgelster Aug 8, 2026 6/10
skill GitHub

jurisdiction-latam: LATAM Legal Data Packs With Sourced, Dated Lines

A jurisdiction layer for Claude covering Latin America: neutral skills plus per-country legal data packs where every line carries its official source and a date. Explicitly not a substitute for a lawyer.

legallatamskillsspanish
by Danielmc09 Aug 8, 2026 5/10
skill GitHub

de-anthropocentric-research-engine: 900+ Markdown Research Skills

A large pure-markdown skill library for autonomous research, organized into 9 composable packages across a 4-layer hierarchy (Campaign, Strategy, Tactic, SOP). It supports non-linear orchestration with backtracking and wires in 6 MCP integrations including Semantic Scholar. Aimed at letting the agent drive literature review and hypothesis generation while you set direction.

skillsresearchorchestrationmcpliterature-reviewmarkdown
by yogsoth-ai Aug 8, 2026 8/10
skill GitHub

youtube-to-article: YouTube and Podcast Transcripts to Chinese Longform

A Claude Code skill that converts YouTube videos and podcasts into detailed Traditional Chinese articles, running fully local and offline with no API key required. It does chapter-aligned chunking plus a quality self-check pass, and can derive mind maps, highlight cards and self-quiz cards from the same transcript. Useful mainly for zh-TW users doing deep reading of video content.

skillyoutubetranscriptiontraditional-chineseoffline
by final90006-sketch Aug 8, 2026 5/10
skill GitHub

codeck: Generate Slide Decks from Claude Code Without Manual Layout

A Claude Code skill that turns written content into finished presentation decks, exporting to PPTX and related slide formats. The pitch is removing the manual parts of deck building — no Keynote, no dragging boxes around, no picking font sizes. Python-based and one of the more popular deck-generation skills at 200+ stars.

skillslidespptxpresentationsdocument-generation
by hiyeshu Aug 8, 2026 7/10
skill GitHub

academic-de-llm: Strip the Tells That Make Prose Read as Machine-Written

A ruleset for removing the stylistic markers that give away agent-written text, ordered by how often each marker actually shows up in measured samples — formatting habits first, older paste-era artifacts last. Claims are sourced, and anything unsourced is explicitly labelled as such. Handy as a final editing pass over drafts an agent produced for you.

writingeditingprosestyleacademic
by tae898 Aug 8, 2026 6/10
skill GitHub

wsqskills: Claude Code Skills and Hooks for WSQ Courseware Authoring

A bundle of skills, slash commands, subagents, and hooks aimed at producing WSQ training material — slide decks, lesson plans, learner guides, and assessments — against one academy's house standards. Very domain-specific to Singapore vocational courseware, but it is a concrete worked example of encoding a document house style into a Claude Code plugin.

skillshooksslash-commandscoursewaredocument-generation
by tertiarycourses Aug 8, 2026 5/10
skill GitHub

agent-skills: Autonomous Issue Runners, Adversarial Gates, and Parallel Bug Hunts

A personal collection of Claude Code skills, steering rules, and multi-agent workflows. The distinctive pieces are autonomous issue runners that pick up tickets end to end, adversarial review gates, and parallel bug-hunting fan-outs. Worth a look if you are designing your own multi-agent review patterns.

skillsmulti-agentcode-reviewautomation
by roufmlp Aug 8, 2026 5/10
skill GitHub

Zero-Lero: Strip Telltale AI Writing Patterns from Brazilian Portuguese Text

A skill that removes the giveaways of AI-generated pt-BR prose: filler openers like "e importante ressaltar", forced binary contrasts, and overuse of gerunds. It is calibrated against a corpus of real human writing rather than generic style rules. Niche, but a useful reference if you are building language-specific editing skills.

writingportugueseeditingskill
by ViniciusStanula Aug 8, 2026 5/10
skill GitHub

ea-skills: The Enterprise-Architecture Lifecycle as Agent Skills over a Deterministic Core

Turns unstructured architecture input into validated ArchiMate 3.2 models, generated views, and ISO 42010 documentation, all versioned in git. The agent skills sit on top of a deterministic core so the outputs are checkable rather than improvised. Aimed at teams that need living architecture governance instead of stale diagrams.

architecturearchimategovernanceiso-42010skills
by dithiothreitol Aug 8, 2026 6/10
skill GitHub

linkedin-animated-infographics: Deterministic Looping GIF Infographics from a Claude Skill

A Claude skill paired with a CLI pipeline that designs and renders lightweight looping GIF infographics sized for LinkedIn. Rendering is deterministic, so the same input produces the same output rather than a fresh improvisation each run. Includes RTL and Arabic text support.

infographicsgiflinkedinrenderingrtl
by imMamdouhaboammar Aug 8, 2026 6/10
skill GitHub

ConsolePlus-PromptPlus Plugin: Pick the Right .NET Console Control Without Guessing

A plugin that guides Claude Code through building .NET console apps with the ConsolePlus/PromptPlus libraries. It determines the correct layer, checks whether interactive controls can actually run in the target context, and narrows 21 available controls to the right one. Removes a class of API-choice mistakes an agent would otherwise make blind.

dotnetconsolepluginlibrary-guidance
by FRACerqueira Aug 8, 2026 5/10
skill GitHub

QAIA: Turn a User Story into an ISTQB Gherkin Test Book and Playwright Tests

Agentic QA for Claude Code that takes a user story and produces an ISTQB-grounded Gherkin test book plus runnable Playwright tests. It is delivered as markdown skills only, with no shipped code and no API key required. Attractive if you want test generation grounded in an actual testing standard.

qatestinggherkinplaywrightistqbskills
by QAIA-Project Aug 8, 2026 7/10
skill GitHub

rockfish-skills: Claude Skills for the Rockfish Synthetic Data SDK

A set of Claude skills covering the Rockfish synthetic data SDK. It gives the agent working knowledge of the SDK's API so it can generate and manipulate synthetic datasets without guessing at call signatures. Relevant mainly if you already use Rockfish.

skillssynthetic-datasdkvendor
by Rockfish-Data Aug 8, 2026 5/10
skill GitHub

workflow-secretary-suite: Skills That Keep a Project Record and Roadmap Honest

A suite of Claude Code skills for maintaining the project record, roadmap, documentation, and tooling. It deliberately stays out of the coding itself, acting as a secretary to the work rather than doing the work. A good fit if your docs drift out of sync with what was actually built.

documentationroadmapproject-managementskills
by qupunto Aug 8, 2026 6/10
skill GitHub

capforge: Just-in-Time Capability Forge for Coding Agents

Builds agent capabilities on demand instead of preloading everything into the system prompt. The idea is to keep startup context small and forge the specific capability when a task actually needs it.

capabilitiescontextjust-in-time
by SuperMarioYL Aug 7, 2026 5/10
skill GitHub

atlassian-browser-skills: Jira and Confluence Without an API Token

Reads and writes Jira and Confluence through your already-logged-in local browser (Safari, Chrome, or Edge) instead of the API. Built for corporate environments where security policy blocks the Atlassian MCP and API tokens.

jiraconfluencebrowseratlassianenterprise
by baekchangjoon Aug 7, 2026 7/10
skill GitHub

COG-second-brain: 33 Skills, 10 Agents, and a V-Model Verification Loop

A self-evolving second brain with skills, agents, and a people CRM, built around a closed-loop harness where the worker never grades its own homework. Includes paired anti-slop design skills for marketing and product UI. Works with Claude Code, Cursor, Kiro, Gemini CLI, and Codex.

second-brainskillsverificationcrm
by huytieu Aug 7, 2026 6/10
skill GitHub

skillmaxx: Auto-Detect and Install the Right Skills for Your Stack

Scans your project, ranks relevant agent skills with calibrated weights, removes near-duplicates via content similarity, and installs them with no configuration. Supports Cursor, Claude Code, Copilot, and other agents.

skillsinstallerdiscoveryautomation
by luckdevx Aug 7, 2026 7/10
skill GitHub

Ontotect: Ontology Engineering Skill for Design Through Governance

A skill covering the full ontology lifecycle: design, construction, review, repair, optimization, refactoring, validation, and governance. Niche, but thorough if you work with knowledge graphs or formal domain models.

ontologyknowledge-graphmodeling
by Moonweave-AI Aug 7, 2026 5/10
skill GitHub

simon-says: Playground Rules for Exact Execution and Less Bloat

A rule set covering exact execution, defensive testing, debugging, and alignment, aimed at making AI builders more predictable. Mainly a curated set of behavioral constraints you can drop into a project.

rulestestingdebuggingalignment
by jawsublime-byte Aug 7, 2026 5/10
skill GitHub

sales-framework: Seven Sales Principles as a Claude Code Skill

Packages a 20-year sales veteran's seven-principle framework plus CXO dealmaker insights into a Claude Code skill. Built by KudoMetrics for founders and sales teams working out of the terminal.

salesbusinessframework
by KudoMetrics-Techologies-Private-Limited Aug 7, 2026 5/10
skill GitHub

dig-deeper: Turn a Real Experience Into Social Content via Interview

A Claude Code skill that runs a guided interview over one of your actual experiences and turns the answers into social media content. The interview step is the point, since it keeps the output grounded in something that happened.

contentsocial-mediainterviewwriting
by felixofabio Aug 7, 2026 5/10
skill GitHub

security-review: Run Real Scanners, Then Verify Findings Against Source

A Claude Code skill that runs Semgrep, gitleaks, TruffleHog, Trivy, osv-scanner, and ZAP, then checks each finding against the actual source before reporting it. Covers SAST, secrets across full git history, SCA, IaC, and Supabase/Firebase RLS, in one report tagged to OWASP Top 10 2025.

securitysastsecretsowaspscanners
by cdmx-in Aug 7, 2026 8/10
skill GitHub

ai-audit-skill: Evidence-Backed Audit and Signed Release Approval

An audit workflow for AI-built software covering requirements, tests, evidence, and stated limitations, ending in a signed release approval. Includes iOS and MASVS coverage for mobile work.

auditevidencereleaseiosmasvs
by goonobu-dot Aug 7, 2026 5/10
skill GitHub

gauntlet-loop: Fresh Builder/Critic Rounds With Resumable Proof

An evidence-driven skill that alternates fresh builder and critic rounds against project context, keeping proof resumable across rounds and enforcing integration gates. Works with both Codex and Claude Code.

builder-criticevidencegatesresumable
by Yash-1511 Aug 7, 2026 6/10
skill GitHub

feature-sliced/skills: Official Agent Skills for Feature-Sliced Design

Agent skills for applying Feature-Sliced Design v2.1 in frontend projects, published by the Feature-Sliced organization itself. Worth having if your frontend already follows FSD and you want an agent to respect the layer boundaries.

fsdfrontendarchitectureskills
by feature-sliced Aug 7, 2026 7/10
skill GitHub

news-reviewer: News Item to Briefing With Devil's-Advocate Questions

A Claude Code skill that converts a news item into a research briefing: verified facts, historical parallels, and questions arguing the other side. The devil's-advocate step is what keeps it from being a summarizer.

researchnewsbriefingcritical-thinking
by mertcanciy Aug 7, 2026 5/10
skill GitHub

arena: Token-Driven Design System Built to Be Operated by Agents

A design system for React, Angular, and Tailwind shipped as two npm packages plus a Claude Code plugin and an Agent Skill. Designed so an agent can drive the tokens directly rather than guessing at your visual language.

design-systemtokensreacttailwindplugin
by dravensoft-dev Aug 7, 2026 6/10
skill GitHub

gophers: 26 Production-Grade Go Skills for Claude Code and Beyond

A set of 26 Go-focused skills covering production concerns, usable from Claude Code, Gemini CLI, and opencode. Worth a look if your agent keeps writing Go that compiles but does not read like Go.

goskillsproductionbackend
by muratmirgun Aug 7, 2026 7/10
skill GitHub

ai-video-prompt-skills: 31 Skills for Kling, Seedance, and Veo

A set of 31 Claude Code skills for prompting image-to-video models, written from production A/B measurements rather than intuition. The measurement provenance is what separates it from the usual prompt-tip lists.

videopromptingklingveoab-testing
by kanno321-create Aug 7, 2026 6/10
skill GitHub

agile-ledger: Plain-Markdown Scrum From Ideas to Releases

A product management skill that keeps ideas, backlog, sprints, releases, and bug tracking in plain Markdown inside the repo, driven by slash commands. Product management lives next to the code instead of in another tab.

product-managementscrummarkdownslash-commands
by nunoamorim99 Aug 7, 2026 6/10
skill GitHub

korean-writing: Fix the Awkward Korean That AI Writes

A Claude Code plugin that prevents translation-ese, AI slop, and double passives in Korean through rule skills, with a hook that automatically catches the obvious AI patterns.

koreanwritinglintinghooki18n
by HarryJhin Aug 7, 2026 6/10
skill GitHub

guide-your-ai-art: Diagnose the Output Instead of Rewriting the Prompt

Measures what an AI-generated image actually produced and diagnoses from there, rather than the usual loop of tweaking the prompt and hoping. Also covers getting the result onto a real app surface.

image-generationdiagnosticsdesignmeasurement
by wan-huiyan Aug 7, 2026 5/10
skill GitHub

CrowdStrike fusion-skills: Official Skills for Falcon Fusion Workflows

CrowdStrike's own agent skills for building Falcon Fusion workflows: action discovery, YAML authoring, deployment, execution monitoring, and best practices for triggers, conditions, loops, and HTTP Actions. Notable as a vendor-published skill set.

crowdstrikesecuritysoarofficialyaml
by CrowdStrike Aug 7, 2026 7/10
skill GitHub

awesome-chinese-ai-tools: 116 Verified Chinese-Language Skill Packs

A library of 116 skill packs, 57 in Chinese and 11 original to the project, all verified as real, plus a directory of 47 AI tools with links tested daily. The verification claim is the differentiator among skill-list repos.

skillschinesecollectioncurated
by sanhuang520-ship-it Aug 7, 2026 5/10
skill Reddit

Using ASD-STE100 Simplified Technical English to Curb Verbose Output

A CLAUDE.md block that asks for Simplified Technical English on coding work: sentences under 20 words, active voice, one instruction per sentence, one meaning per word, no idioms, explicit articles. Scoped to chat reports, PR titles and descriptions, and issue comments rather than everything.

claude-mdwritingverbositystyleste100
by henrypoydar Aug 7, 2026 6/10
skill GitHub

skills-agro: Agronomy Skills for Claude Built on Brazilian Standards

Agronomic skills encoding the Brazilian 5a Aproximacao (CFSEMG/MG) and Boletim 100 (IAC/SP) fertilizer recommendation standards. A good example of an agent skill built around a real domain reference rather than general advice.

agronomybrazildomain-skillportuguese
by guilherme-iaparaagronomos Aug 7, 2026 5/10
skill GitHub

brand-asset-art-director: Text-Free Image Prompts With Overlay Specs

Generates text-free image prompts plus overlay specifications for any brand asset, with adapters for Midjourney v7, FLUX, GPT-image, and SDXL. Keeping text out of the render and in the overlay is the useful part.

brandingimage-generationmidjourneyfluxdesign
by ChloeVPin Aug 7, 2026 5/10
skill GitHub

imagine-agy: Let Claude Code Generate Images via Antigravity CLI

An agent skill plus text-to-image CLI that turns Google's Antigravity CLI into an image generator for hero art, icons, and illustrations, callable from Claude Code or the terminal.

imagesantigravitytext-to-imagecli
by dyrok Aug 7, 2026 6/10
skill GitHub

dstack: A Design Review Stack for Claude Code Interfaces

A set of Claude Code skills that review, improve, animate and systematize UI work. Each critique cites a specific design rule and proposes a numeric fix rather than vague advice. Aimed at developers who ship interfaces without a designer on hand.

designuireviewskills
by AnimaEcho Aug 7, 2026 7/10
skill GitHub

think-like-a-pm: Agent Skills for Product Owners, Not Coders

Agent skills aimed at the person who owns the product rather than the codebase. The first skill, 'Context is Queen', focuses on framing product context for agents; three more are in progress. A useful angle if you use Claude Code for product work.

product-managementskillscontext
by hgambas Aug 7, 2026 6/10
skill GitHub

bookmark-this: Turn Scattered Links Into a Queryable Markdown Library

Converts saved links into a structured Markdown bookmark library that AI agents can query. Each entry is normalized so an agent can search and cite sources instead of re-fetching pages. Handy as a lightweight personal knowledge base for agent workflows.

bookmarksknowledge-basemarkdownresearch
by nikkogibler Aug 7, 2026 6/10
skill GitHub

glb-buildings-skill: Procedural Building Models From a JSON Spec

Turns a JSON document of floor bands into a validated low-poly glTF building for Unreal, Unity or three.js. Ships with a three.js blueprint editor and an agent-facing CLI so Claude can generate geometry directly. Useful for anyone prototyping 3D environments with an agent.

3dgltfgamedevthreejsprocedural
by hec-ovi Aug 7, 2026 6/10
skill GitHub

proveit: Validate Product Ideas Before You Build Them

Runs structured discovery on a product idea, scores confidence, dispatches a research swarm, and produces a technical handoff deck. The output is meant to be the input to an actual build rather than a standalone document. Aimed at pre-implementation validation.

productresearchvalidationdiscovery
by cla1redonald Aug 7, 2026 6/10
skill GitHub

rulebase-skills: 149 Agent Skills for Customer Support and CX Ops

A large library covering support QA, compliance, RevOps, forecasting and coaching, installable one at a time via 'npx rulebase-skills install <slug>'. Works with Claude Code, Codex and Cursor. Notable for being a non-engineering skill collection at real scale.

customer-supportskillscxoperations
by rulebase-co Aug 7, 2026 7/10
skill GitHub

infostyle-skill: Infostyle Editing for Russian Text in Claude Code

Applies the Russian 'infostyle' editing tradition — clarity, factual grounding, cutting filler — to text inside Claude Code. Targets writing quality rather than code. Niche but well-scoped for Russian-language writers.

writingrussianeditingskills
by Julianalost754 Aug 7, 2026 5/10
skill GitHub

claude-mentor-skills: Guardrails Earned From Real Repo Incidents

Three Claude Code skills — build discipline, review discipline, and an Opus 5 circuit breaker — each written in response to an actual incident where an agent session damaged a repo. The rules are specific rather than generic best practice. Useful if you run agents with broad write access.

guardrailssafetyreviewskills
by LilyCTM Aug 7, 2026 7/10
skill GitHub

agent-vision-toolkit: Give Text-Only LLM Agents Eyes

A vision toolkit and skill providing image Q&A, OCR, screenshot understanding, visual grounding and image-to-SVG for agents that have no native vision. Drops into Claude Code, Codex, OpenCode and Pi. Bilingual docs (Chinese/English).

visionocrscreenshotsmultimodalskills
by Anionex Aug 7, 2026 8/10
skill GitHub

performance-ads-ia: Auditable Meta Ads Optimization Agent

A Portuguese-language agent for Claude Code and Codex that plans, analyzes and optimizes Meta Ads campaigns with an audit trail for every recommendation. Every change is traceable back to the data that motivated it. Domain-specific but a good template for auditable marketing agents.

adsmarketingmetaanalytics
by davigraeff-v4 Aug 7, 2026 6/10
skill GitHub

governed-agent-skills: A Governance Constitution for Agent Work

Defines a constitution and working method covering both multi-agent and solo-agent workflows — what agents may decide, what needs escalation, how work is recorded. Aimed at teams that need agent output to be defensible. More policy than tooling.

governancemulti-agentprocessskills
by Ezra144israel Aug 7, 2026 6/10
skill GitHub

agentic-workstation: A 48-Pack Baseline for AI-Native Development

A workstation baseline with 48+ skill packs, sub-agents, MCP templates and loop-engineering primitives, targeting Claude Code, opencode, Cursor, Copilot and Gemini CLI. Meant as a starting configuration rather than a single tool. Large surface area — expect to prune.

skillsmcpsubagentsworkstationmulti-cli
by ulises-jeremias Aug 7, 2026 7/10
skill GitHub

acstack: Skills That Prove Their Work Instead of Describing It

Claude Code skills built around runnable exit criteria, honest evals, and guards that are demonstrated firing rather than merely declared. The premise is that a skill claiming success should show the check that passed. A useful pattern even if you don't adopt the pack.

skillsevalsverificationguards
by AaravChadha Aug 7, 2026 7/10
skill GitHub

skill-bill: Governed Skills on a Durable Kotlin Runtime

Packages engineering judgment into governed skills and executes them on a durable Kotlin runtime so agents follow the process consistently, resume after interruption, and stay within a bounded context. The durability angle is what separates it from prompt-only skill packs. Heavier setup than a Markdown skill.

skillskotlindurable-executiongovernance
by oila-gmbh Aug 7, 2026 6/10
skill GitHub

skillcast: Turn a Tutorial Video Into a Runnable Agent Skill

Feeds a tutorial video in and produces a skill a coding agent can actually execute, reading the screen rather than the transcript. Captures the steps that narration skips over. A neat way to convert tribal knowledge in recordings into agent instructions.

skillsvideoscreen-readingautomation
by obeskay Aug 7, 2026 7/10
skill GitHub

super-productivity-skill: Task and Time Tracking From Claude Code

A Claude Code skill that manages tasks, scheduling and time tracking in Super Productivity through the app's local REST API. Everything stays on your machine. Good example of wrapping an existing local API as a skill.

taskstime-trackingrest-apiskills
by rokokol Aug 7, 2026 6/10
skill GitHub

skillz: BPMN Diagramming, LinkedIn Pipeline, and Meta-Skills

Agent skills in SKILL.md format for Claude, OpenClaw and Codex, including BPMN-aware Mermaid diagramming, a voice-to-LinkedIn-post pipeline, and meta-skills that turn recurring work into new reusable skills. The meta-skill angle is the interesting part. Standards-conformant SKILL.md files.

skillsbpmnmermaidmeta-skills
by OKHP3 Aug 7, 2026 6/10
skill Reddit

Why Behavioural Skills Fail at Making Claude Less Chatty

Argues that skills are the wrong mechanism for always-on communication style: they're built to encode workflows and domain know-how for specific tasks, not to shape user-facing tone. Explains why the popular 'be concise' skills underdeliver and where that instruction actually belongs. Useful framing before you write another behavioural skill.

skillsverbosityoutput-stylediscussion
by ibn_larry Aug 7, 2026 7/10
skill GitHub

skill-latest-screenshot: Open Your Newest Windows Screenshot

A one-call skill for Claude Code and Grok Build that opens your most recent Windows screenshot without a directory hunt. Deliberately token-cheap. Small but removes a repetitive step in visual debugging.

screenshotswindowsskillsutility
by yoobrain Aug 7, 2026 5/10
skill GitHub

decision-canvas: Interactive HTML Canvases for Hard Decisions

A Claude skill that turns a complex decision into a self-contained interactive HTML canvas with evidence states, editable assumptions and a portable decision record. The artifact outlives the conversation. Useful for architecture choices you'll need to justify later.

decisionshtmldocumentationskills
by nicolas-diez Aug 7, 2026 6/10
skill GitHub

kill-slop: Audit AI Writing Against Your Own Voice

Two Claude Code skills that capture your writing voice, audit text against it, and rewrite only the passages that fail. Selective rather than a wholesale rewrite, so your original phrasing survives. Aimed squarely at the AI-tell problem.

writingvoiceeditingskills
by aixarizzo Aug 7, 2026 7/10
skill Reddit

A CLAUDE.md Communication Style Block That Tames Opus 5

A short communication-style section for CLAUDE.md asking for direct, plain British English, no consultant-speak, and radical candour including admitting uncertainty. The author reports a large improvement over default Opus 5 verbosity. Copy-pasteable in a few lines.

claude-mdverbositypromptingopus-5
by Schpickles Aug 7, 2026 6/10
skill GitHub

skilldrop: 51 Skills for Knowledge-Worker Deliverables

Skills for the artifacts knowledge workers actually ship — ADRs, design docs, PRDs, runbooks, decks, threat models, adversarial reviews — plus three reviewer subagents and six role-based packs. Conforms to the Agent Skills open standard and installs into Claude Code, Cursor, Codex, Copilot, Kiro and Antigravity. Broad coverage with a consistent format.

skillsdocumentationadrprdportable
by sananthanarayan Aug 7, 2026 7/10
skill GitHub

write-like-me: Build a Style Skill by Being Interviewed

A CLI that interviews you about your writing, captures the answers, and emits a Claude Code skill encoding your voice. Getting the style from an interview avoids needing a large corpus of prior writing. Complements the audit-based approach of other voice tools.

writingvoiceskillscli
by substantialityinhibition972 Aug 7, 2026 6/10
skill GitHub

cac-ciso-toolkit: NIST-Aligned Claude Skills for Security Leaders

Composable skills covering risk register maintenance and translating security posture for a board audience, aligned to NIST frameworks. Targets the CISO's writing and reporting load rather than technical scanning. Composable, so you can take just the pieces you need.

securitycisonistriskskills
by cyberaware-creations Aug 7, 2026 6/10
skill GitHub

breadcrumbs: Cue-Placement Templates and Guardrails for Agents

Provides memory and guardrail templates built on cue placement, plus a self-tested CI kit and the white paper explaining the approach. The CI kit tests the guardrails themselves, which is rarer than it should be. Good if you want the reasoning as well as the artifacts.

memoryguardrailscitemplates
by The-825 Aug 7, 2026 6/10
skill GitHub

pr-walkthrough-skill: Review Agent-Authored PRs One Layer at a Time

Walks you through a PR an agent wrote in layers rather than as one wall of diff, collecting your comments as it goes. Built for the case where you didn't write the code and need to build understanding before judging it. Works in Claude Code, Codex and Cursor.

code-reviewpull-requestsskills
by thekie Aug 7, 2026 7/10
skill GitHub

read-me-launcher: Agent Skill for Polished, Secret-Safe READMEs

Generates GitHub READMEs with real visual craft while scanning for secrets that shouldn't ship in documentation. Combines presentation with a safety check most README generators skip. Small scope, done properly.

readmedocumentationsecretsskills
by thatdudealso Aug 7, 2026 5/10
skill GitHub

consistent-naming: Name New Files by Surveying the Repo First

An agent skill that checks existing repo structure and conventions before naming a file or project, instead of inventing a fresh style each time. Prevents the naming drift that accumulates across many agent sessions. Very small scope.

namingconventionsskills
by thatdudealso Aug 7, 2026 5/10
skill GitHub

task-dispatch: Route Small Tasks Fast, Big Tasks Through Process

A triage layer built on mattpocock/skills that judges how heavy a task is: trivial work gets done directly, substantial work is routed through the full process. Avoids paying full-ceremony cost on one-line changes. Chinese-language documentation.

triageroutingskillsworkflow
by Number-2222 Aug 7, 2026 5/10
skill GitHub

VMware-AIops: Claude Code Skills for vCenter and ESXi Monitoring and Ops

Two Claude Code skills for VMware infrastructure: vmware-monitor is read-only and safe to point at production, while vmware-aiops enables full operations. Splitting them lets you grant an agent visibility without granting it the ability to change anything.

vmwareinfrastructuredevopsread-only
by vmware-skills Aug 6, 2026 6/10
skill GitHub

claude-code-docs: Live Anthropic Docs Inside Claude Code via Metadata Plugin

A 3 MB plugin that ships metadata only and fetches official Claude documentation from Anthropic's servers on demand, so nothing is redistributed or goes stale. Adds an auto-discovery skill, instant search, interactive HTML courses, and doc changelog reports.

documentationpluginsearchreference
by costiash Aug 6, 2026 7/10
skill GitHub

skillbox: A Hand-Polished Personal Collection of Claude Code Skills

An ongoing collection of Claude Code skills the author writes, uses long-term, and keeps refining, published in Chinese. Framed as a starting point rather than a finished library - the stated goal is that you build your own from it.

skillscollectionchinese
by zxc7563598 Aug 6, 2026 5/10
skill GitHub

comfyui-chenxin: Local-First ComfyUI Mega-Skill With 662 Workflow Templates

A large local-first ComfyUI skill for Claude Code bundling 80 model prompt recipes and 662 workflow templates, with hardware-aware model selection so it picks something your GPU can actually run. Includes a self-updating knowledge base and an end-to-end manga pipeline.

comfyuiimage-generationtemplateslocal-first
by cxin21 Aug 6, 2026 7/10
skill GitHub

ASI OS: Claude Code Starter Kit With /onboard, /audit, /level-up, /grill

An MIT-licensed starter kit that adds four commands to Claude Code: /onboard to get oriented in a repo, /audit to review it, /level-up to improve it, and /grill to interrogate your own assumptions. A reasonable opinionated default for a fresh setup.

starter-kitcommandsonboardingaudit
by sameerch1b Aug 6, 2026 6/10
skill GitHub

skills: Version-Controlled Agent Skills With Cross-Platform Installers

A personal skills repository organised for version control, paired with installers that work across platforms. The value is the packaging pattern - treating skills as versioned artifacts with a real install path rather than files you copy by hand.

skillsversioninginstaller
by dm1681 Aug 6, 2026 5/10
skill GitHub

graphsmith: Crash-Safe, Non-Duplicating Agent Workflows as a Single Skill

One skill that structures agent workflows so they survive crashes, never redo completed work, and stay grounded rather than inventing results. Portable across Claude Code, Codex, Gemini CLI, Cursor, Windsurf/Devin, Hermes, and Copilot.

workflowdurabilityidempotencyportable
by SathiaAI Aug 6, 2026 7/10
skill GitHub

ai-film-skills: Local AI Short-Film Pipeline Skills for a Single 12GB GPU

A Chinese-language skill suite for running a local AI short-film pipeline - LTX, Wan, and MiniMax H3 - on a single 12GB card. Includes 1600+ lines of documented failure modes and a mechanism to keep generated shots from converging on the same look.

videolocal-inferencegpuchinese
by L-Trunks Aug 6, 2026 6/10
skill GitHub

SciAgent-Skills: 197 Bioinformatics and Life-Science Skills for Claude Code

A 197-skill library covering RNA-seq, single-cell analysis, drug discovery, and proteomics, reporting 92.0% accuracy on BixBench. It powers OmicsHorizon and is one of the more substantial domain-specific skill collections published for Claude Code.

bioinformaticsscienceskillsbenchmarks
by jaechang-hits Aug 6, 2026 8/10
skill GitHub

apple-design-skill: Human Interface Guidelines Translated for the Web

A research-backed agent skill covering fluid motion, the Human Interface Guidelines, colour systems, dark mode, SF Symbols, layout, and accessibility - all mapped onto web implementation. A revamp of Emil Kowalski's MIT-licensed apple-design skill.

designapplehigaccessibility
by ChloeVPin Aug 6, 2026 7/10
skill GitHub

skills: Multi-Model Advisory Board Plus a Five-Skill Team Workflow Pack

Two portable skill sets: an advisory board that puts a hard decision to several models and reconciles their answers, and a five-skill pack for tracked, multi-session, agent-assisted development on a team.

multi-modeldecision-makingteamworkskills
by timharris707 Aug 6, 2026 6/10
skill GitHub

agent-pr-skills: Five Checks for Agent PRs, Built From 2,204 Merged PRs

Five checks to run against your coding agent's pull request before a human maintainer sees it, derived from analysing 2,204 real merged agent PRs. The empirical grounding is what distinguishes this from generic review checklists.

code-reviewpull-requestsqualityempirical
by sjh9714 Aug 6, 2026 8/10
skill GitHub

claude-code-laravel-starter: CLAUDE.md Is RAM, docs/ Is Disk

A lean documentation skeleton for Laravel projects using Claude Code, built on one memorable rule: CLAUDE.md holds what must always be in context, docs/ holds everything the agent can page in on demand.

laravelphpclaude-mddocumentation
by albertoarena Aug 6, 2026 6/10
skill GitHub

claude-laravel-event-sourcing: Generate Spatie Event-Sourced Laravel Code

A Claude Code skill for designing and generating event-sourced domain code in Laravel using Spatie's event sourcing package. Narrow scope, but event sourcing is exactly the kind of boilerplate-heavy pattern an agent handles well with guidance.

laravelevent-sourcingspatiephp
by albertoarena Aug 6, 2026 6/10
skill GitHub

data-analysis-skills: Turn CSV/Excel Into Interactive Single-File Reports

Confirms your industry and audience first, then cleans, analyses, and emits a single-file interactive HTML report in a conclusion-first six-section structure with every chart interpreted. Explicitly refuses to invent industry benchmarks, imply causation from correlation, or draw firm conclusions from small samples. Supports Claude Code, Codex, and WorkBuddy.

data-analysisreportinghtmlchinese
by cabbage2000-lab Aug 6, 2026 6/10
skill GitHub

liarjs-skills: Browser Fingerprint Consistency Testing From Your Agent

Runs liarjs from Claude Code, Codex, Cursor, or Copilot to score a browser against itself across 40 consistency checks spanning canvas, WebGL, WebGPU, audio, fonts, and WebRTC, cross-checked against the TLS/HTTP layer. Intended for Playwright and Puppeteer harness QA and CI regression gates.

testingbrowserfingerprintingplaywright
by liarjsdev Aug 6, 2026 5/10
skill GitHub

macos-disk-cleanup: Agent Skill for Diagnosing macOS 'System Data' Bloat

A macOS disk cleanup skill for Claude Code and Codex that diagnoses what is actually inside the opaque 'System Data' bucket, using read-only scan scripts. Documents 10 traps that lead to misdiagnosis or data loss - the safety notes are the real content.

macosdiskcleanupread-only
by himynameisben Aug 6, 2026 5/10
skill GitHub

mattpocock-skills-zh-tw: 35 Matt Pocock Agent Skills in Traditional Chinese

A full Traditional Chinese localisation of Matt Pocock's 35 agent skills with install and runtime behaviour preserved. Ships a bilingual GitHub Pages reading site with a skill overview map, a learning path, and OpenCode/TRAE install guides.

localizationchineseskillstypescript
by shumingyang-opencode Aug 6, 2026 6/10
skill GitHub

arge-tesvik-skills: TUBITAK Grant Tracking and 5746 Compliance Skills

A Claude Code plugin for Turkish R&D incentive work: tracking TUBITAK TEYDEB/ARDEB calls, pre-assessing project proposals, preliminary patent search, and checking compliance with law 5746. Unofficial and not affiliated with TUBITAK.

turkeygrantscomplianceresearch
by ibrahim-isikli Aug 6, 2026 5/10
skill GitHub

context-engineering-protocol: Source-Attributed, Approved Context Packages

Portable agent skills for assembling context packages where every claim carries a source attribution and a human approves the package before it is used. Aimed at stopping unsourced assumptions from entering the agent's working context.

context-engineeringattributionapprovalportable
by linkpranay-ai Aug 6, 2026 5/10
skill GitHub

Clean-Backend: Production-Hardening Skill for Endpoints, Payments, and Jobs

A Claude skill that applies production-hardening practices whenever you design, write, or review backend code, with specific coverage for endpoints, payment flows, destructive deletes, background jobs, and alerting. The failure modes it targets are the ones that only surface under real traffic.

backendproductionpaymentsreliability
by AllanOps Aug 6, 2026 7/10
skill GitHub

MindMirror: Agent-Agnostic Self-Knowledge Skill Pack in Chinese

A pure-markdown skill pack for self-reflection: a 22-question evidence-based profile, a ten-dimension digital twin, and a 90-day life-planning experiment. Written to run on any AI assistant rather than a specific harness.

personalreflectionmarkdownchinese
by Jianing1117 Aug 6, 2026 5/10
skill GitHub

awesome-agents: 109 Claude Code Subagents in 16 Enforced Engineering Teams

109 specialist subagents organised into 16 engineering teams, plus 11 commands and 10 skills, arranged along an architecture-build-verify-ship chain with the delegation order enforced rather than suggested. Installable as a plugin marketplace.

subagentsteamsmarketplacedelegation
by bakhod1r Aug 6, 2026 7/10
skill GitHub

resonate-skills: Agent Skills for Durable, Crash-Safe Resonate Workflows

Official agent skills for building with Resonate, the durable execution framework for long-running, crash-safe workflows. Useful when the thing you are asking an agent to build must itself survive restarts.

resonatedurable-executionworkflowsreliability
by resonatehq Aug 6, 2026 6/10
skill GitHub

claude-code-skills: 16 Skills for the Unglamorous Work That Ships Software

A curated pack of 16 Claude Code skills - ship-it, readme-forge, security-sweep, git-rescue, devlog and more - where each was researched first and included only if no prominent existing skill already solved it. Explicitly not a 40-skill kitchen sink.

skillscuratedshippingtooling
by 0xmortuex Aug 6, 2026 7/10
skill GitHub

video-prompt-builder: AI Video Prompts for Kling, Sora, Vidu, and Runway

A Chinese-language skill for constructing AI video generation prompts across text-to-video, image-to-video, and video-to-video, with three complexity tiers (L1/L2/L3) and platform-specific output for Kling, Sora, Vidu, and Runway.

videopromptingchinesegenerative
by BH2-4 Aug 6, 2026 5/10
skill GitHub

bearing: Cognitive Routines That Keep Agents Anchored to Your Project

An intel layer that keeps coding agents oriented on what the project actually is: authoritative north-star documents, a task-core that survives context compaction, and domain-expert review passes. Supports Claude Code, Cursor, Zed, and Codex.

contextcompactionanchoringreview
by ReidenXerx Aug 6, 2026 6/10
skill Reddit

Framing CLAUDE.md Rules as Introspection Beats Plain Instructions

Inspired by the emotion vectors paper, the author rewrites stubborn CLAUDE.md rules to ask Claude to introspect on its behavioral impulses rather than simply forbidding a behavior. Reports better control over verbosity and output bloat than direct instructions achieved.

claude-mdpromptingintrospectionverbosity
by trying2bLessWrong Aug 6, 2026 6/10
skill Reddit

A Progressively Disclosed Skill Index for Whole-Codebase Architecture Docs

A primary skill acts as an index over grouped architecture areas - plugins, agent stream, skills, db, service APIs - and each of those indexes a deeper documentation set. The agent updates the system whenever the architecture changes, cutting token waste since it looks up the right reference doc instead of searching the codebase.

skillsprogressive-disclosurearchitecturetoken-efficiency
by ZeroTwoMod Aug 6, 2026 6/10
skill Reddit

A Minimax H3 Video Skill Tested Across Claude Code, Kimi K3, and Qwen 3.8

A Claude Code skill automating Minimax H3 video creation: search for reference character images, generate them with Seedream 4.5 if none fit, upload, then write a structured script covering scene, lighting, mood, and three dialogue beats. The post compares how Claude Code, Kimi K3, and Qwen 3.8 Max each handled the same workflow.

videoskillsmodel-comparisonautomation
by marupelkar Aug 6, 2026 6/10
skill Reddit

A DAG Orchestration Skill for 24-72 Hour Semi-Supervised Agent Runs

A skill for semi-supervised execution of very long tasks - 24 to 72 hours - with a built-in verification loop, at a frankly acknowledged heavy token cost. The skills are written in Korean and will occasionally emit Korean; the author suggests just telling it which language you prefer. At least one Max 20x account required.

orchestrationdaglong-runningverification
by Competitive-Net-5306 Aug 6, 2026 6/10
skill GitHub

agent-skills-kit: Toolkit for authoring and packaging Agent Skills

A starter kit for writing your own Agent Skills, containing a meta skill that helps Claude author skills, plus templates and a worked sample. Includes scripts that validate a skill's structure and package it for distribution. Aimed at people who publish skills rather than just consume them.

skillsauthoringpackagingtemplatesvalidation
by bcastelino Aug 5, 2026 7/10
skill GitHub

claude-briefs: A lightweight focus system for working with Claude Code

A minimal convention for keeping Claude Code focused on one brief at a time instead of drifting across a whole repo. Deliberately small — no framework, just a working pattern. Worth a look if heavier planning systems feel like overkill.

focuscontextworkflowplanning
by naxoc Aug 5, 2026 5/10
skill GitHub

awesome-claude-skills-zh: Chinese-language curated list of Claude Skills

A curated index of Claude Skills, resources and tooling for customizing Claude workflows, maintained in Chinese alongside English. Covers skills for writing, analysis and development. Handy entry point for Chinese-speaking Claude Code users.

awesome-listskillschineseresources
by AICL-Lab Aug 5, 2026 6/10
skill GitHub

Skills_Curator: Evaluate skills before installing and remember the verdict

A Claude Code skill that reviews a candidate skill before you install it and records the decision permanently. The point is to decide once and never re-litigate whether a given community skill is worth trusting. Useful as the skill ecosystem grows faster than anyone can audit it.

skillssecuritycurationinstallreview
by captkernel Aug 5, 2026 7/10
skill GitHub

claude-red: Library of offensive security skills for the Claude skills system

A collection of SKILL.md files that prime Claude with structured methodology for specific security testing areas, from SQL injection to exploit development. Each skill encodes an expert workflow for one attack surface. Intended for authorized penetration testing and security research.

securitypentestingskillsred-teamresearch
by 0xwilliamortiz Aug 5, 2026 6/10
skill GitHub

opensearch-upgrade-navigator: Read-only agent skill for OpenSearch upgrades

An agent skill that plans and validates an OpenSearch version upgrade for any cluster, proving it will still work as-is on the newest release. Strictly read-only, so it never mutates the cluster it inspects. Built for the 2026 OpenSearch Agent Skills Hackathon.

opensearchupgradedevopsskillread-only
by madhankb Aug 5, 2026 6/10
skill GitHub

plainpaper skills: Agent Skills for the platforms marketers run campaigns in

A set of open-format Agent Skills covering the ad and campaign platforms marketing teams actually use. Works with Claude Code, Codex, Cursor, Copilot and Gemini CLI. One of the few skill collections aimed at marketing rather than engineering.

marketingskillsadscross-agentcampaigns
by plainpaperio Aug 5, 2026 6/10
skill GitHub

skillmeld: Discover and merge community Claude skills into one vetted set

Finds existing community skills, security-scans them, and melds the best parts into a single tailored set rather than installing dozens separately. Reduces both context bloat and the audit burden of third-party skills. Complements install-time evaluators.

skillsdiscoverymergesecurity-scancuration
by ifylab Aug 5, 2026 7/10
skill GitHub

FileMaker-AI-vocabulary: FileMaker 26 API compressed to ~7,000 tokens

Every FileMaker 26 function and script step condensed into a token budget small enough to keep resident in context: names, signatures, return types, step IDs and platform support. The goal is to stop Claude inventing functions and misordering parameters. A good example of the vocabulary-layer pattern for niche platforms.

filemakerreferencecontextskilllow-code
by andykear Aug 5, 2026 6/10
skill GitHub

ai-dev-toolkit-pt-br: Portuguese rules, skills and configs for coding agents

A Portuguese-language toolkit of rules, skills and configuration for Claude Code, Cursor and Windsurf. Removes the English-first friction for Brazilian teams. Straight translation-and-adaptation work rather than new tooling.

portugueseskillsrulescursorwindsurf
by LucasSantana-Dev Aug 5, 2026 5/10
skill GitHub

skill-mesh: 47 portable skills with parallel Claude and GPT adapters

A provider-neutral skill pipeline covering an autonomous plan, build, review and ship loop across Claude and GitHub Copilot/GPT. Includes judges, graders and scorers plus install and release tooling, with three Claude-native skills excluded from the portable set. Notable for treating portability as a first-class constraint.

skillsportablecopilotpipelineorchestration
by aberson Aug 5, 2026 7/10
skill GitHub

tdd-agent-skill: TDD skill with hard RED-GREEN-REFACTOR gates for agents

A research-backed TDD skill that enforces real red-green-refactor gates, discovers your stack, and uses mutation testing instead of coverage as the quality signal. Includes explicit anti-reward-hacking rules so the agent cannot game its own tests. Works with any SKILL.md-compatible agent.

tddtestingmutation-testingskillquality
by ChloeVPin Aug 5, 2026 8/10
skill GitHub

agent-smith: Tools, scripts, skills and agents for agent-driven development

A maintained collection of building blocks for agent-driven development, spanning scripts, skills and subagents. Broad rather than deep — useful as a source of individual pieces. Actively developed by a working developer.

skillsscriptscollectionsubagents
by s3rgiosan Aug 5, 2026 5/10
skill GitHub

nsauditor-ai-agent-skill: Agent skill for NSAuditor security audit tooling

Gives any MCP-aware coding agent built-in knowledge of NSAuditor's tools, schemas, plugins and audit workflows. Vendor-published, so it is essentially a documentation layer for their product. Works with Claude Code, Cursor and Windsurf.

securityauditmcpskillvendor
by nsasoft Aug 5, 2026 5/10
skill GitHub

software-quality-skills: Skills distilled from a software quality knowledge base

Claude Code skills derived from a structured software-quality knowledge base rather than written ad hoc. Encodes established practice on testing, review and maintainability. Useful if you want your agent's quality bar to come from somewhere defensible.

qualityskillstestingreviewpractices
by stereobooster Aug 5, 2026 6/10
skill GitHub

r3ckon-style: Six Claude Code skills that enforce one developer's house style

Six skills that make an agent write both code and prose the way their author does. A concrete worked example of encoding personal style as skills instead of a sprawling CLAUDE.md. Fork-and-adjust material rather than something to install as-is.

styleskillswritingconventions
by localhostd3veloper Aug 5, 2026 5/10
skill GitHub

open-source: Skill that generates a project's full open source governance

Generates README, LICENSE, REUSE/SPDX metadata, CONTRIBUTING and the rest of the open-source governance surface for any project. Works with Claude Code and OpenCode, and is written for hackathon-speed setup. Spanish-language documentation.

open-sourcelicensespdxgovernanceskill
by igarbayo Aug 5, 2026 6/10
skill Reddit

A Claude skill that asks 697 engineering questions before writing code

A skill front-loading 697 questions across 15 engineering domains to pin down what a task must actually resolve. Backed by 60 decision cards distilled from Kleppmann, Nygard, Evans, Ousterhout and others. An extreme take on the plan-before-you-code pattern.

skillrequirementsengineeringdesignplanning
by AffectionateSport135 Aug 5, 2026 7/10
skill GitHub

Subsidy Agent Skills: AI Skill Set for Japanese SME Grant Applications

A collection of AI agent skills that help Japanese small and medium businesses research subsidies, check eligibility requirements, and draft grant applications, built on the public jGrants API. Released under MIT license and useful as a reference for building domain-specific research-and-drafting skill workflows beyond Japan's subsidy system.

skilljapangrantsresearch
by yoshi2210 Aug 5, 2026 5/10
skill GitHub

Coinpaprika Skills: Query Crypto Market Data (CEX/DEX) from Claude Code

Official Claude Code skills for querying Coinpaprika and DexPaprika, covering CEX prices, DEX pools, tokens, and OHLCV data. Useful for anyone building crypto-market analysis or trading workflows directly inside Claude Code.

skillcryptomarket-data
by coinpaprika Aug 5, 2026 6/10
skill GitHub

auteur: A Claude Code Skill That Directs Website Builds Like a Film

Treats web design as film direction, producing a commit-sheet, generated assets, and a build, then gates every ship with an executable anti-slop linter. A structured, quality-gated pipeline for AI-driven website work rather than ad hoc prompting.

skillweb-designquality-gate
by agiwhitelist Aug 5, 2026 7/10
skill GitHub

nestjs-playbook-skill: Opinionated Claude Skill for NestJS Backends

A reasoned, opinionated Claude Skill encoding best practices for building small-to-medium NestJS backend projects. Useful for NestJS developers who want Claude Code to follow a consistent architectural playbook instead of ad hoc scaffolding.

skillnestjsbackend
by Kianibound Aug 5, 2026 6/10
skill GitHub

fornax: Read-only skills for coding agents to orient, map, plan, and review code

fornax is a set of portable, single-purpose skills that let an agent orient itself in a codebase, map dependencies, plan changes, and review code, strictly read/plan/report. Useful when you want an agent's analysis without risking unsupervised edits.

skillcode-reviewread-only
by tacticaldoll Aug 5, 2026 6/10
skill GitHub

gald3r: 22-agent framework with 100+ skills and 149 commands across 21 AI tools

A large AI dev framework bundling 22 agents, 100 core skills plus 142 addon skill packs, and 149 commands, portable across 21 tools including Claude Code, Cursor, Copilot, Windsurf, Cline, and Gemini. Uses file-based memory so context persists across sessions.

skillmulti-toolmemory
by Gald3r-Labs Aug 5, 2026 6/10
skill GitHub

observer-skill: Study a hard video with your coding agent via MCP transcription

A Node service that transcribes a video, serves a player page, and exposes MCP tools so your coding agent can answer questions at your exact pause point and render verified charts explaining the content. Combines a Claude skill, MCP server, browser TTS, and STT for an interactive study session.

mcpskillvideostudy
by hec-ovi Aug 5, 2026 7/10
skill GitHub

quant-agent-skills: 8,000 lines of quant research orchestration rules for CC

A set of Claude Code / Codex skills for quant research workflows: concept research, single-stock analysis, and industry analysis, distilled from 6 months of daily production use. Notable for the depth (8k lines of orchestration rules), suggesting real battle-testing rather than a quick scaffold.

skillquantfinance
by Howard-Jerry Aug 5, 2026 7/10
skill GitHub

pristine-skill: Agent Skill Enforcing First-Time-Right Code Changes

A cross-platform agent skill (Claude Code, Codex, OpenCode) that enforces the "First-Time Principle" -- every change must be written in its final form, with no patches, no "what changed" comments, no leftover code, and no drift between local and deployed state. Useful for teams who want agents to produce clean, complete diffs instead of incremental band-aid edits.

skillcode-qualitycross-platform
by newbanser Aug 5, 2026 6/10
skill GitHub

sovereign-skills: 20 Production-Grade Skills for Setup, Review, and Governance

A bundle of 20 skills covering project setup, scope discipline, code review, security, session management, governance, ops, and quality audits (including eval-leakage and doc-drift checks). Works across Claude Code, Codex, and Cursor, aiming to standardize agent discipline beyond just coding tasks.

skillgovernancecode-review
by AlexZio00 Aug 5, 2026 5/10
skill GitHub

video-reverse-engineering: Agent Skill to Reverse-Engineer How a Video Was Made

A Claude Agent Skill that extracts real keyframes, subtitles, and audio from a video, then produces a shot list, ready-to-paste AI image/video generation prompts, and a full replication guide covering both AI and live-action production paths. Useful for creators who want to replicate the style of an existing video or study how it was constructed.

skillvideocontent-creation
by whaojie797-design Aug 5, 2026 6/10
skill GitHub

adsense-compliance-auditor: Claude Skill for AdSense and AdMob Compliance

A dynamic skill engine that audits web and mobile apps for Google AdSense/AdMob monetization compliance, checking layout safety, ads.txt validation, and anti-CLS layout hooks against current live ad policies. Niche but useful for publishers who want an automated pre-flight check before enabling ads.

skillmonetizationcompliance
by kiraak-h Aug 5, 2026 5/10
skill GitHub

fabric-agent-skills: Agent Skills for Microsoft Fabric Connect, Load, and Model

A set of Agent Skills for working with Microsoft Fabric, covering connecting to data sources, loading, and modeling, with rules validated against a live Fabric environment. Useful for data engineers using Claude Code or similar agents inside a Microsoft Fabric/Power BI stack.

skillmicrosoft-fabricdata-engineering
by emirdegirmenci Aug 5, 2026 5/10
skill GitHub

immut-agent: Agent Skill and CLI for Notarizing Files with immut

An agent skill and CLI that has your AI agent locate important files -- contracts, IP, compliance records -- and send each one to the immut.io proof layer, producing a verifiable, tamper-evident timestamp of when the file existed and that it has not changed. Useful for teams needing lightweight, agent-driven document notarization.

skillcompliancenotarization
by enroh-ops Aug 5, 2026 5/10
skill GitHub

code-annotations: Write @anno Comments, Let Claude Execute Them in Batch

A skill that lets developers write lightweight "@anno" annotations directly in source code as inline instructions, which Claude then reads and executes in batch across the codebase. A neat pattern for queuing up many small, localized changes without writing a full prompt for each one.

skillcode-annotationbatch-editing
by zlj-zz Aug 5, 2026 6/10
skill GitHub

ai-code-review-skill: Pre-Merge Review Skill Targeting AI Code Failure Modes

A pre-merge code review skill specifically aimed at failure patterns common in AI-generated code: deleted historical patches, unverified assumptions written as comments, and over-engineering. Uses a six-stage review process plus 23 language-specific guides, and works with Claude Code, Cursor, and Codex.

skillcode-reviewai-generated-code
by casperkwok Aug 5, 2026 6/10
skill GitHub

Reader-First Writing Skills: 12-Skill Editorial System

A set of 12 editorial skills plus independent review agents for Claude Code and Codex that structure, draft, diagnose, and revise documents while preserving the authors original meaning. Aimed at long-form writing rather than code.

writingeditorialskill
by OC-NeuralSense Aug 5, 2026 6/10
skill GitHub

Bambu 3MF Export: Claude Code Skill for Sliceable Print Files

A Claude Code skill that exports STL meshes directly into sliceable Bambu Studio .3mf projects, with print settings baked in and parts auto-packed across named plates. Useful for anyone using Claude Code to automate 3D-printing prep.

3d-printingskillbambu-studio
by m-esm Aug 5, 2026 6/10
skill GitHub

Han-Communication: A Plugin to Make Claude's Output More Readable

An open-source (MIT) plugin with a custom agent and three skills -- general readability guidance, editing existing text for readability, and explaining technical detail clearly -- aimed at fixing Claude's dense, jargon-heavy output. Ships with a default writing voice you can override with your own, and the guidance docs are usable even without installing the plugin itself.

readabilitywriting-styleplugin
by mxriverlynn Aug 5, 2026 6/10
skill Reddit

Sweet Dream: A Free Recreation of Claude's Enterprise 'Dreams' Skill

An open-source attempt to recreate Claude's officially announced 'Dreams' managed-agent capability, which is currently limited to enterprise plans with extra usage cost. The author reports it works, though it hasn't been tested long-term, and it's free to use right now.

dreamsmanaged-agentsexperimental
by No_Combination_6429 Aug 5, 2026 7/10
skill GitHub

ui-review: automated UI/UX review skill for Claude Code

Uses the agent-browser CLI to catch UI/UX bugs — text overflow, wrapping bugs, horizontal scroll, overlapping elements, tap targets, dark-mode and WCAG zoom/reflow issues — across mobile through desktop viewports. Maps each finding to the source file responsible and supports baseline/diff regression runs that skip unchanged pages.

uiaccessibilitytestingskill
by cdmx-in Aug 5, 2026 8/10
skill Reddit

agent-dev-toolkit: one skills core, adapters for Claude Code, Cursor, Codex, and more

Maintains a single agent-neutral core of skills, policy, and spec-driven-development contracts, then uses per-agent adapters to publish it into Claude Code, Cursor, Codex, Copilot, and others, so a skill update doesn't need to be copied by hand into every tool.

skillscross-toolspec-driven-development
by walter-dexter Aug 5, 2026 6/10
skill GitHub

skills: deterministic Shopify/SEO/GEO checks backed by real-scan prevalence data

A set of agent skills that check Shopify, e-commerce, SEO, and GEO issues using deterministic checks backed by prevalence data from real scans rather than guesswork. Works with Claude Code, Cursor, Codex, and Gemini CLI via the open Agent Skills standard.

seoe-commerceshopifyskills
by maxbuildog Aug 5, 2026 6/10
skill GitHub

explain-it-to-me: Coding agent explains what it built as linked Obsidian notes

A Claude Code skill that has the agent write one Obsidian note per new concept after each delivery: why it appeared, an analogy, and what breaks if you change it. Aimed at people who need to understand agent-built code without reading it directly.

skillobsidiandocumentation
by JessieMeguro Aug 4, 2026 7/10
skill GitHub

skills: TDD, refactoring, and ensemble-review skills for disciplined coding agents

A skill collection for making agent-driven code cheaper and safer to change: continuous-specification (spec-driven TDD), nullables (mock-free testing of I/O code), bounded refactoring, micro-commits, and ensemble-review (three concurrent model reviews synthesized into one revision plan).

skilltddrefactoringcode-review
by jonfazzaro Aug 4, 2026 8/10
skill GitHub

claude-tier: /tier Skill for Cost-Efficient Model Tiering

A tiny Claude Code skill that installs a quality-first, cost-efficient model/effort-tiering rule into a project's CLAUDE.md via the /tier command. Lets teams standardize which model tier to use for which kind of task without hand-writing the rule each time.

skillclaude.mdcost-optimizationmodel-selection
by thephenyl02-creator Aug 4, 2026 6/10
skill GitHub

Claude Code Skill for Parametric FDM 3D-Print Modeling

A Claude Code skill for parametric FDM 3D-print modeling using trimesh/manifold3d/build123d, with a headless view-screenshot-iterate loop so the agent can visually check its own models. Useful for makers who want an agent-driven CAD workflow.

skill3d-printingcadheadless
by m-esm Aug 4, 2026 6/10
skill GitHub

Blink Build Studios: Open-Source Claude Skills Marketplace

A collection of open-source Claude Code skills from Blink Build Studios, published as an installable plugin marketplace. Description is thin on specifics but provides a ready-made source of skills to browse.

skillmarketplaceplugins
by Blink-Build-Studios Aug 4, 2026 5/10
skill GitHub

Lecture-to-Notes: Local Pipeline Turning Recordings into Synced Notes

A Claude Code skill plus CLI that converts lecture recordings into structured, grounded notes with a synced HTML viewer combining video, timestamped transcript, and summary. Uses a local GPU pipeline (Whisper ASR, slide extraction, OCR, VLM) so no cloud transcription is needed.

skilltranscriptionlocal-gpunotes
by drpwchen Aug 4, 2026 6/10
skill GitHub

Nen: Six Agent Skills Mapped to Performance, Refactoring, and More

Nen ships six installable agent skills themed around performance, refactoring, launch, reverse engineering, reliability, and orchestration. A playful but practical grouping of common engineering skill categories for Claude Code.

skillrefactoringperformanceorchestration
by rlaope Aug 4, 2026 6/10
skill GitHub

ship-guard-skills: Post-AI-Coding Safety Checks as Agent Skills

A set of MIT-licensed agent skills that act as guardrails after AI coding sessions — checking for leaked secrets, running pre-merge checks, triaging flaky tests, and detecting env/flag drift. Designed to catch mistakes before they ship.

skillsafetycisecrets
by Wanbinyu Aug 4, 2026 6/10
skill GitHub

dsl-skills: Cross-Agent Skills for Visual QA and Email Automation

A set of cross-agent skills covering visual QA and email automation workflows, usable across different coding agents including Claude Code. Provides ready-made skill definitions for two specific automation domains.

skillvisual-qaemail-automation
by dengshangli Aug 4, 2026 5/10
skill GitHub

Blender Industrial Kit: Parametric, Verifiable 3D Modeling Skill

A field-tested discipline for industrial-product 3D modeling in Blender that's parametric, headless, and verifiable, shipping docs, verification gates, and a Claude Code skill plus agent pipeline. Aimed at product designers who want an agent-driven, checkable Blender workflow.

skillblender3d-modelingheadless
by kai-chop Aug 4, 2026 6/10
skill GitHub

Curated Claude Code Skills for Image, Music, and Instructional Design

A curated collection of Claude Code skills covering AI image production, AI music production, instructional design, and general workflow improvement. Good starting point for creative and non-coding use cases of Claude Code skills.

skillcreativeinstructional-design
by phillipalcock Aug 4, 2026 6/10
skill GitHub

code-clipping: Claude Code Skill for Short-Form Video Editing

A Claude Code skill that inspects a source video clip, proposes short-form edit ideas, and exports finished vertical clips ready for TikTok, Reels, or Shorts. Brings agent-driven video editing suggestions into the Claude Code workflow.

skillvideo-editingshort-form-content
by phillipalcock Aug 4, 2026 6/10
skill GitHub

use-case: Verified-Only Use-Case Catalog Skill for Codebases

An agent skill that walks both the codebase and the live running app in a browser to build a verified use-case catalog, generating an in-app panel, a demo deck, and a report of dead/unused features. Useful for teams wanting an accurate, agent-verified map of what a product actually does.

documentationskillcodebase-analysis
by succtorlin Aug 4, 2026 6/10
skill GitHub

pillars: Tiered Convention Files to Keep Coding Agents Aligned

pillars is an open standard that decomposes a monolithic AGENTS.md/CLAUDE.md into tiered 'pillar' files describing a project's conventions, decisions, and constraints. Useful for keeping coding agents consistently aligned with project rules as codebases and instruction sets grow.

conventionsagents-mdproject-config
by hannsxpeter Aug 4, 2026 6/10
skill GitHub

research-lab-skills: Agent Skills for the Full Research Lifecycle

A composable set of Claude Code Agent Skills covering literature review, research logs, experiment tracking, analysis, lab presentations, manuscript writing, and peer review. Useful for academic and research teams wanting to apply Claude Code to the full scientific workflow, not just coding.

researchacademicskill-collection
by zi-yue-1129 Aug 4, 2026 6/10
skill Reddit

wiseman: Self-Building Codebase Wiki Plugin for Claude Code

wiseman is a Claude Code plugin that generates a human-and-agent-readable wiki for your project: a /wiseman-summon skill researches dependencies and builds wiki pages, a hook checks the wiki for relevant lessons before each coding task, and /wiseman-dashboard opens a readable view. Useful as a free, self-hosted alternative to paid context tools like context7, accumulating project-specific lessons over time.

pluginwikiproject-memory
by TGoddessana Aug 4, 2026 7/10
skill GitHub

Skill-Bazaar: Open Collection of Agent Skills (SKILL.md) by Category

An all-in-one, categorized open collection of AI Agent Skills in SKILL.md format, part of a broader 'Mega AI Bazaar' project. Useful as a browsable directory when looking for existing Claude Code skills to reuse rather than writing your own from scratch.

skill-collectiondirectoryopen-source
by Drvivek34 Aug 4, 2026 5/10
skill GitHub

course-quiz-builder: turn course markdown into a quiz webpage

A Claude Code skill and slash command that converts course markdown into a single self-contained HTML quiz page with randomized questions, an answer key, and pass/fail scoring, then publishes it to GitHub Pages. Handy for course creators wanting quick interactive assessments.

skilleducationgithub-pages
by the3ma Aug 4, 2026 6/10
skill GitHub

Skill for iterative review/revision of design and planning docs

A Claude Code skill that runs repeated rounds of review and revision over design and planning documents until all flagged issues are resolved and closed. Simple structured process for tightening specs before implementation.

skillplanningreview
by MarkAsir Aug 4, 2026 5/10
skill GitHub

ux-writing: Claude Code skill for interface microcopy

A Claude Code skill encoding interface microcopy rules plus an 'AI-tell' strip pass to make button and error text read as human-written rather than obviously AI-generated. Useful for teams wanting consistent, natural UI copy from agent-driven design work.

skilluxcopywriting
by humbleteam Aug 4, 2026 6/10
skill GitHub

Skill for auditing codebases against the EU AI Act

A Claude Code skill for answering questions about the EU AI Act (Regulation 2024/1689) and running static/dynamic compliance audits on codebases to flag prohibited practices, missing transparency controls, and unmet high-risk safeguards. Useful for teams needing AI regulatory compliance checks baked into their dev workflow.

skillcomplianceeu-ai-act
by DirtyBeastAfterTheToad Aug 4, 2026 6/10
skill GitHub

claude-code-plugins: opinionated plugin and workflow extension pack

A collection of opinionated plugins and workflow extensions for Claude Code from a single maintainer. Useful as a grab-bag of ready-made customizations for users who want pre-built conventions rather than authoring their own from scratch.

pluginsworkflow-extensionscustomization
by bengous Aug 4, 2026 5/10
skill GitHub

ai-agent-skills: goal-mode skill keeps agents working until CI is green

A skill for Cursor and Claude Code that puts the agent into 'goal-mode,' keeping it iterating until tests, lint, and CI all pass rather than stopping after a single attempt. Installable via npx skills add for a quick drop-in addition to a project's skill set.

skillsgoal-modecitesting
by shenwell Aug 4, 2026 6/10
skill GitHub

practicaltypography: typography skill based on Practical Typography

A Claude Code / AI agent skill that encodes Matthew Butterick's Practical Typography rules so agents can audit and produce publication-grade text formatting. Useful for anyone generating documents, reports, or web copy where typographic quality matters.

typographywritingskilldocuments
by danium Aug 4, 2026 6/10
skill GitHub

skilldrift: Dependabot-style drift detection for Claude Code Skills

Monitors installed Claude Code Skills for upstream changes, re-scores risk using SkillSpector, and auto-opens GitHub Issues when drift is detected — supply-chain security for the growing Skills ecosystem. Ships as both a GitHub Action and a Go CLI.

securitysupply-chainskillsgithub-action
by kpab Aug 4, 2026 7/10
skill GitHub

skills-workflows: pipeline-orchestration skill pack for Claude Code

A set of pipeline-orchestration skills for Claude Code covering publish-post, agents-md-generator, work-tracking, feature-spec, and stage-draft tasks. Useful as ready-made building blocks for structuring multi-step content and dev workflows.

skillspipelineorchestrationcontent
by slogsdon Aug 4, 2026 6/10
skill Reddit

Keep CLAUDE.md stable by moving changing info out of it

A practical technique for stopping CLAUDE.md from going stale: keep only rarely-changing facts (verification commands, hard limits, known-problem notes) in the file, and move volatile session state to a handoff note, live status to a script the file points to, and project history to a separate memory index. Also separates planning and coding into distinct session files to keep each one focused.

claude-mdcontext-managementbest-practices
by Euphoric_Daikon_3582 Aug 4, 2026 6/10
skill GitHub

pdp-audit: Claude skill for ecommerce product-page UX audits

A Claude Code skill that runs research-backed UX and conversion audits of ecommerce product detail pages, producing prioritized, evidence-based reports. Useful for teams wanting a repeatable, agent-driven conversion-rate review process.

ecommerceux-auditskillconversion
by llizell Aug 4, 2026 5/10
skill GitHub

Claude Code Skill: Map AI-Assistant Visibility (AI Mindshare)

A Claude Code skill that measures how visible a company or market is to AI assistants like ChatGPT, mapping which brands get recommended and why. Useful for marketers or founders wanting to understand and improve their presence in AI-generated answers.

skillseoai-visibility
by unfamiliar-city Aug 4, 2026 6/10
skill GitHub

Battle-Tested Claude Code Skills: Ship-to-Babysit Pipeline

A collection of Agent Skills for Claude Code including a 'ship → babysit' pipeline for taking work from implementation through monitoring. Distributed via positronick.com for developers wanting reusable, proven skill workflows.

skillpipelineautomation
by nsollazzo Aug 4, 2026 6/10
skill GitHub

rook-claude: Claude Code Plugin Marketplace for Rook Maintainers

A Claude Code plugin marketplace tailored to maintainers of the Rook storage project, bundling code review, triage, and systemic-PR skills. A concrete example of building a project-specific plugin marketplace on top of Claude Code.

plugin-marketplaceskillmaintainer-tools
by jhoblitt Aug 4, 2026 5/10
skill GitHub

sshlg-skills: Umbrella Installer for the ssheleg Skill Family

A single installer for six agent skills (super-ux, task-pipeline, agent-sync, make-skill, sheleg-design, seo-aeo-audit) that work across Claude Code, Cursor, Codex, and 70+ other agent tools. Simplifies setting up a curated skill set across multiple coding agents at once.

skillinstallermulti-agent
by ssheleg Aug 4, 2026 6/10
skill GitHub

agent-toolkit: Composable Skills, Agents, Loops and MCP Templates

A composable toolkit of skills, subagents, loop patterns, and MCP templates that works across Claude Code, Cursor, OpenCode, Copilot, Windsurf, and Pi. Aimed at developers who want reusable building blocks for constructing agent workflows rather than starting from scratch each time.

skillmcptoolkit
by ulises-jeremias Aug 4, 2026 6/10
skill GitHub

consult: Engineering-Quality Skills That Keep Humans in the Loop

A set of skills for AI coding agents focused on engineering quality, designed to keep a human reviewer in the loop rather than letting the agent act fully autonomously. Targets teams wary of unchecked agentic changes to production code.

skillcode-qualityhuman-in-the-loop
by kreek Aug 4, 2026 5/10
skill Reddit

A Curated List of Claude Code Skills and Tools Actually Used Daily

A practitioner's roundup of the Claude Code skills, plugins, MCPs, and companion tools that stuck as part of a real workflow rather than just looking good in a demo, including Ponytail (minimal-diff discipline), OldHand (full-flow QA), React Doctor (React anti-pattern scanner), Trail of Bits security skills, Muster (unified process/log runner), Ruflo (multi-agent coordination), Serve Sim (iOS Simulator control), and ScrapeGraph AI (LLM-based web extraction). Useful as a filtered starting point for discovering tools worth trying instead of sifting through every new release.

skillrounduptooling
by not_bsb7838 Aug 4, 2026 7/10
skill GitHub

Claude Code Skill for MiniMax H3 Open-Weight Video Model

A Claude Code skill providing a prompt framework and ComfyUI model/quantization reference plus troubleshooting for MiniMax H3, an open-weight omni-modal video model, covering text-to-video, image-to-video, first-last-frame, and reference-to-video generation. Useful for developers using Claude Code to drive local video-generation pipelines.

skillvideo-generationcomfyui
by teskor-hub Aug 4, 2026 6/10
skill GitHub

21-Skill Discipline Pack for Claude Code with Global Rules and Guardrails

A Chinese-language collection of 21 Claude Code skills plus global 'iron rules' and physical guardrails meant to make Claude Code follow engineering discipline consistently, with one-click install. Aimed at teams wanting a stricter, more standardized Claude Code workflow out of the box.

skillguardrailsstandardization
by xcodethink Aug 4, 2026 7/10
skill GitHub

ForgeCat: Registry of Production-Ready Agent Profiles

A registry and marketplace for production-ready AI agent profiles usable with Claude Code, Cursor, and Codex, letting users search, install, and contribute packages. Useful for quickly bootstrapping agent configurations instead of writing them from scratch.

skillregistryagent-profiles
by nota-america Aug 4, 2026 5/10
skill GitHub

agent-plugins: durable agent memory + adversarial multi-agent review

A set of Claude Code plugins covering agent memory and verification: a second-brain for durable domain-agent knowledge, apiary for multi-contributor knowledge bases, and a scout-generator-critic-mediator pattern for adversarial multi-agent review.

pluginmemorymulti-agentreview
by ahartzog Aug 3, 2026 7/10
skill GitHub

marketing-strategist: ad strategy skill before campaign setup

A Claude skill that builds ad strategy before campaign setup — covering research, hypotheses, platform selection, phased budgeting, and KPI definition. Documentation is in Russian.

skillmarketingstrategy
by ai-hub-open Aug 3, 2026 5/10
skill Reddit

Attention Control: terse, action-first output style for coding agents

A skill/output style for Claude Code (and Codex, Cursor, Gemini CLI, Copilot, Zed) built around ADHD-friendly, air-traffic-control-style terseness — replacing hedged, wordy responses with direct action statements like exact commands and file:line references.

output-styleskilladhdclarity
by aaddrick Aug 3, 2026 7/10
skill GitHub

juanjuan-team: adversarial-collaboration multi-agent skill

An adversarial-collaboration multi-agent skill for Claude Code with 7 specialized agents (leader, convener, architect, frontend, coder, reviewer, docs-researcher) that independently audit every decision to counter single-agent cognitive tunneling. Includes an 11-phase workflow, 4 operating modes (Safe/Normal/Auto/YOLO), a weighted decision engine, and automatic backups.

multi-agentskillreviewworkflow
by dxkjuanjuan Aug 3, 2026 7/10
skill GitHub

el-estudio: full game-studio plugin for Claude Code (Spanish)

A Claude Code plugin that turns the agent into a complete game studio covering design, Unity, 3D/2D art, animation, and audio — with 159 knowledge files, 7 agents, and 7 skills. Documentation is in Spanish.

game-devunitypluginskill
by MichaelH14 Aug 3, 2026 7/10
skill GitHub

pwnloop: autonomous pentest-lab engagement loop for Claude Code

An autonomous lab-machine engagement loop for Claude Code that runs Kali Linux in a container, drives it via a skill, and rewrites its own methodology notes after each run — useful for practicing/automating CTF-style penetration testing labs.

securitypentestskillkali
by euriconicacio Aug 3, 2026 7/10
skill GitHub

claude-instruction-ablation: cut always-on CLAUDE.md/skill bloat

A rubric and footprint-measurement tool for identifying always-on instruction bloat — CLAUDE.md content, rules, and skill descriptions — that degrades coding agent performance as a setup ages, with a multi-repo workflow for trimming it.

skillclaude-mdtoken-efficiencycontext
by evolsb Aug 3, 2026 7/10
skill Reddit

Skills vs MCP: two different layers, not competitors

Argues that skills and MCP solve different problems rather than one replacing the other: MCP is the capability layer giving an agent access to external tools/resources, while a skill is operational knowledge about when and how to use that access, loaded only when needed. Proposes a three-layer split: CLAUDE.md for persistent facts, skills for on-demand procedures, MCP for external access.

skillmcpconcepts
by Particular_Luck80 Aug 3, 2026 6/10
skill GitHub

docflow: ADR-driven documentation workflow for coding agents

A skill set for scaffolding and managing Architecture Decision Records, a plan queue, and AGENTS.md conventions for the Claude Code and pi coding agents — includes a bootstrap skill plus lifecycle skills to author, queue, ship, and audit ADRs.

skilladrdocumentationworkflow
by EvolveHQ Aug 3, 2026 7/10
skill GitHub

clean-my-code: approval-gated code-quality audit skill

An approval-gated code-quality audit skill covering Clean Code, SOLID, DRY, KISS, YAGNI, design-pattern justification, maintainability, testability, and scalability — requires explicit approval before making changes.

skillcode-qualityaudit
by PabloViniegra Aug 3, 2026 6/10
skill GitHub

charles-claude-skills: context handoff, bootstrap, and catalog skills

Production-quality Claude Code skills for context handoff between sessions, project bootstrap, and a skill catalog, evaluated against Anthropic's writing-skills and skill-creator rubric with 100% trigger accuracy.

skillcontext-handoffbootstrap
by cabaynes Aug 3, 2026 6/10
skill GitHub

OmniRank — SEO/AEO/GEO Growth Engine Skills

A growth-engine skill set for Claude Code and Cursor covering SEO, AEO, GEO, and social growth. v0.1.0 ships an audit skill that scores crawl-hygiene and AI-visibility gates, plus a geo-artifacts skill that generates llms.txt, llms-full.txt, and facts.json for AI crawlers.

seogeomarketing
by bemoshiur Aug 3, 2026 6/10
skill GitHub

llm-council-cc — Multi-Advisor Decision Review Skill

A Claude Code skill adapted from Karpathy's LLM Council concept: five advisors independently analyze a decision, blind peer-review each other with a forced ranking, and a chairman delivers one final verdict. Useful for stress-testing important decisions from multiple angles.

decision-makingmulti-agent
by Carlos-Padilla-Bravo Aug 3, 2026 7/10
skill GitHub

human-prose — Readability Rules Grounded in Psycholinguistics

A Claude Code skill encoding sentence-level readability rules for prose meant to be read by humans, with each rule pinned to psycholinguistics research. Helps rein in overly dense or unnatural AI-generated writing.

writingreadability
by homeowmorphism Aug 3, 2026 6/10
skill GitHub

CommonTrace — Shared Knowledge Base Plugin

A Claude Code plugin bundling slash commands, hooks, and a skill for working with CommonTrace's shared knowledge base. Lets a team query and contribute to a common knowledge store from within Claude Code.

knowledge-baseplugin
by commontrace Aug 3, 2026 5/10
skill GitHub

hubspot-license-fit — Right-Size Your HubSpot License

A Claude skill and CLI that reads a HubSpot portal read-only and reports the minimum tier its actual usage requires, citing the specific feature and verification date behind each claim. Deliberately avoids asserting what you currently pay, since the API can't see billing. Pure Python, no dependencies.

hubspotcost-optimization
by meticulosity Aug 3, 2026 6/10
skill GitHub

janaabg-operations — Growth-Ops Skills for Local Businesses

Twenty growth-operations skills plus industry playbooks for local service businesses, agencies, and B2B, built for Claude Code and Hermes Agent. Pure markdown with no executable code.

growth-opsmarketing
by On-mission96 Aug 3, 2026 5/10
skill GitHub

ads-skills — Ad Campaign Skills for Google, Meta & TikTok

A set of Claude skills covering advertising and marketing strategy, campaign structure, targeting, creative, and budgeting across Google Ads, Meta Ads, TikTok, and more. Aimed at marketers running paid campaigns with Claude's help.

advertisingmarketing
by adkit Aug 3, 2026 5/10
skill GitHub

claude-seo-geo — SEO & GEO Skills for Ranking in Search and LLMs

A set of Claude Code skills covering technical SEO audits, backlinks, AI-optimized content, local SEO, and social amplification — aimed at ranking in both Google and LLM answers like ChatGPT, Perplexity, and Gemini.

seogeo
by Thibaultbm Aug 3, 2026 5/10
skill GitHub

alex-style — Vendored Design Reference Skill

A self-contained design arsenal skill for Claude Code that vendors 20 curated design sources into grep-able local indexes covering components, marketing sections, application UI, shaders, brand logos, color ramps, and review rulebooks. Lets Claude search real design references locally instead of guessing.

designui
by worldofhacks Aug 3, 2026 6/10
skill GitHub

claude-skills (dzivkovi) — Branded Docs, Prose Review & EPUB Export

A set of Claude skills that make output look and read right by default: branded Word and PowerPoint generation, a logic-and-slop prose reviewer, a guided read-along tour of overnight AI work, and Markdown-to-Kindle-EPUB or plain-print-PDF conversion with working links, tables, and local Mermaid diagrams. Usable either as a claude.ai upload or dropped into Claude Code.

documentsexport
by dzivkovi Aug 3, 2026 6/10
skill GitHub

skill-conductor — Architecture-First Skill Lifecycle Tool

Manages the full lifecycle of Claude Code skills through six modes — CREATE, IMPROVE, VALIDATE, REVIEW, OPTIMIZE, PACKAGE — using binary BinEval scoring with threshold-blind, cross-family-calibrated judges. Includes a gated self-update loop, pressure testing, and ten authoring principles grounded in empirical research.

skill-authoringevaluation
by smixs Aug 3, 2026 6/10
skill GitHub

plan-preflight — PASS/FAIL Gate for Implementation Plans

A Claude Code skill that runs preflight checks on implementation plan documents, gating them with a binary PASS/FAIL verdict before work begins. Helps catch weak or incomplete plans before they turn into wasted execution time.

planningquality-gate
by jw1222 Aug 3, 2026 6/10
skill GitHub

codex-handoff — Hand Tasks From Claude Code to OpenAI Codex

A Claude Code skill that delegates tasks to OpenAI Codex — via shell or macOS GUI computer-use — and returns evidence of what was done. Useful for splitting work across coding agent vendors within one session.

codexcross-vendordelegation
by LucasDuys Aug 3, 2026 6/10
skill GitHub

ground-my-ui — Verify UI Contracts Before Redesigning

An agent skill built on the premise that 'ugly' UI is often code quietly lying to its framework: it verifies every prop, slot, enum value, token, icon, and i18n key against the installed source before redesigning, audits who actually owns layout, and locks the contracts into tests.

uiverification
by silkyland Aug 3, 2026 6/10
skill GitHub

handover — Enforced Agent-to-Agent Handover Documents

Defines an enforced handover document format for agent-to-agent handoffs — a strictly validated header plus prose body — with deterministic linting and repo-aware verification. Ships with a trap-based benchmark that measures whether a handoff actually transfers the needed context.

handoffdocumentationverification
by geekidharsh Aug 3, 2026 6/10
skill GitHub

respeak — Humanize AI-Sounding Prose

An editing method and Claude Code/Codex skill for making prose sound like a person wrote it, without changing the underlying facts. Targets the common 'obviously AI-written' tell in drafts.

writingediting
by quietmill Aug 3, 2026 6/10
skill GitHub

gmira — 21 Skills for UI That Doesn't Look AI-Generated

Twenty-one Claude Code skills for building web interfaces that don't read as AI-generated: forces a written visual direction before any element is placed, wires in seven shadcn registries (514 components), sets a GPU performance floor for WebGL/canvas work, and gates every build with Playwright checks across 5 viewports. Targets Next.js, React, and Tailwind v4.

uidesign-quality
by OthmanAdi Aug 3, 2026 7/10
skill GitHub

claude-security-skills — 25 Defensive Security Skills for Claude Code

Twenty-five production-tested defensive security skills covering WordPress, VPS, and Cloudflare/Next.js hardening, AI agent guardrails, MCP security, prompt-injection defense, the OWASP LLM Top 10, LLM-specific failure modes like slopsquatting and hallucinated APIs, incident response, and GDPR/DACH compliance. MIT licensed and described as battle-tested.

securitydefensive
by GoldenWing-360 Aug 3, 2026 8/10
skill GitHub

academic-pdf-translation — Rebuild Translated, Searchable Academic PDFs

An agent skill for translating academic PDF papers into another language while rebuilding them as readable, searchable, page-by-page-verifiable documents. Handles complex tables and figures and finishes with Zotero integration.

translationpdfacademic
by ezra-y Aug 3, 2026 6/10
skill GitHub

cc-handoff — Cross-Machine Session Handover for Claude Code

Creates a handover summary so you can continue a Claude Code task on a different machine, working around the fact that Claude Code's session-resume feature doesn't work across machines.

handoffsessioncross-machine
by clever-cc-plugins Aug 3, 2026 6/10
skill GitHub

ponyatnost — 'Понятность' Explainer-Writing Skill

A Russian-language skill that turns a draft explainer article into text a newcomer can actually understand, running 41 checks across 7 phases with a final gate before it's considered done. Part of the RixAI system.

writingrussian
by morf3uzzz Aug 3, 2026 5/10
skill GitHub

Claude Skills for SaaS Compliance and Trust Operations

Five Claude Skills automating SaaS compliance and trust workflows: security questionnaires, SOC 2 readiness, vendor risk assessment, audit evidence collection, and trust page audits. Aimed at teams that need to move faster through vendor security reviews.

skillcompliancesoc2saassecurity
by mercydeez Aug 2, 2026 6/10
skill GitHub

Claude Skill Generates Narrated Mythic Short Films as Paper Dioramas

A Claude skill that turns a single request into a narrated mythic short film styled as a layered cut-paper diorama, complete with three-colour cardstock worlds and paper-wipe transitions. Outputs one assembled MP4 from a text prompt.

skillvideocreativegenerative
by sadekxD Aug 2, 2026 5/10
skill GitHub

Battle-Tested Claude Skills: Notion GTD, Book Printing, PrusaSlicer

A personal collection of battle-tested Claude skills covering Notion GTD sessions, a book print pipeline, PrusaSlicer profiles, and a language tutor. A grab-bag of real-world automation examples beyond typical dev tooling.

skillnotion3d-printingproductivity
by makukhin-ie Aug 2, 2026 6/10
skill Reddit

Rewriting CLAUDE.md Instructions to Suit Opus 5 Behavior

A developer used Anthropic's Opus 5 prompting guide to audit and rework their CLAUDE.md, finding that many instructions told Opus 5 to do things it already does by default, which Opus 5 then compounded into slower, less accurate runs. Highlights that coding guidelines shared with other tools like Copilot may need to diverge from Opus-5-tuned CLAUDE.md content.

skillclaude-mdopus-5prompting
by our_sole Aug 2, 2026 6/10
skill GitHub

awesome-claude-security: Curated Skills and Agents for Cybersecurity

A curated list of Claude Code skills, agents, memory setups, and profiles for accomplishing cybersecurity tasks, projects, and jobs. An awesome-list style entry point into the security-focused Claude Code ecosystem.

skillsecurityawesome-listcybersecurity
by jassics Aug 2, 2026 5/10
skill GitHub

Claude Code Skill for Designing Mathlib Definitions

An evidence-driven Claude Code skill for designing good Mathlib (Lean 4) definitions, covering precedent excavation, design axes, and compiling example sheets. A niche but rigorous example of a domain-specific research skill.

skillmathliblean4formal-math
by homeowmorphism Aug 2, 2026 5/10
skill GitHub

Claude Code Skill for Adaptive Teaching with a Persistent Learner Model

A Claude Code skill for adaptive teaching on any topic, maintaining a persistent learner model and an evidence-pinned answer protocol across sessions. Aims to tailor explanations to what the learner already knows rather than restarting from scratch each time.

skilleducationadaptive-learning
by homeowmorphism Aug 2, 2026 6/10
skill GitHub

ignite: Shared Claude Code Team Bootstrap Kit

A shared bootstrap for Claude Code teams that bundles skill packages, review hooks, MCP servers, and a common CLAUDE.md into one setup. Aims to keep configuration consistent across a team's repos instead of each developer hand-rolling their own.

bootstrapteamskillshooksmcpclaude.md
by farofy Aug 2, 2026 6/10
skill GitHub

strava-run-analysis: Coaching-Grade Run Analysis in Claude

A Claude skill that analyzes Strava running data to compute decoupling, heart-rate zone time, and pace-at-HR trends that Strava's own dashboards don't surface. Scores execution honestly rather than just reporting raw stats.

skillstravafitnessdata-analysis
by alexandre-thiry Aug 2, 2026 5/10
skill GitHub

monetization-audit: Agent Skill for Finding Revenue Gaps

An agent skill that scans a project, researches its market with sourced evidence, and identifies monetization gaps. Outputs action specs an agent can execute directly, turning research into actionable next steps.

skillmonetizationmarket-researchbusiness
by succtorlin Aug 2, 2026 6/10
skill GitHub

open-geo: Measure Brand Visibility in AI Answers

A Claude Code skill that measures how visible a brand is across AI answer engines (Google AI Overview, ChatGPT, Claude, Gemini, Yandex Alice) by driving a logged-in browser agent to read the actual rendered answer rather than an API response. MIT licensed.

geoseobrand-monitoringai-search
by Pupok462 Aug 2, 2026 6/10
skill Reddit

PROMPTING.md: A Ruleset for Writing and Auditing AI Prompts

A researched framework covering how to write CLAUDE.md/AGENTS.md files, prompts, and plans so instructions actually reach and hold up in the model — including authority conflicts, instruction overload, prompt injection, and compaction survival. Ships as a standalone Markdown file or a packaged skill for Claude Code, Codex, Cursor, and OpenCode. MIT licensed.

promptingclaude.mdskillprompt-engineering
by Anbeeld Aug 2, 2026 7/10
skill GitHub

engineering-excellence: Generated Doctrine and Gates for AI Coding Agents

A one-command setup that turns a repository into a place where AI coding agents follow enforced conventions — generating agent instructions, golden-path examples, and machine-enforced gates for stacks like FastAPI, React, TypeScript, containers, AWS CDK, and GitHub Actions.

agent-instructionsci-gatesconventionsscaffolding
by samar1066 Aug 2, 2026 6/10
skill Reddit

79 CLAUDE.md Rules Tested Against Boris Cherny's 'Delete Every 6 Months' Advice

A practitioner sorted all 79 rules in their CLAUDE.md against advice from Claude Code creator Boris Cherny, who suggests periodically deleting CLAUDE.md/skills/hooks and re-adding instructions only when the model actually struggles without them. Only 22% of the rules turned out to be genuine delete candidates, highlighting how much of typical CLAUDE.md content may be unnecessary bloat.

CLAUDE.mdbest-practicesprompt-engineering
by Bulky_Ad738 Aug 2, 2026 7/10
skill GitHub

oogway: Agent Skill That Traces Every Bug Back to the Change That Caused It

A Claude Code / Codex / Cursor skill that generates a project report reviewing what shipped, tracing every problem back to the specific change that introduced it, and pricing out the cost of each next step. Framed as a post-mortem tool for teams running agentic development.

skillpostmortemreporting
by tensorboy Aug 2, 2026 6/10
skill GitHub

skill-comply: Behavioral Compliance Testing for Claude Code Skills

A Claude Code skill that measures whether agents actually follow the skills, rules, and agent definitions they're given, rather than assuming instructions are being followed. Automated behavioral testing for a problem many CLAUDE.md authors only discover the hard way.

skilltestingcompliance
by shimo4228 Aug 2, 2026 7/10
skill GitHub

claude-harness: Curated MIT-Licensed Agent Skills, Subagents & Rules

A curated, MIT-licensed collection of Agent Skills, subagents, and rules built against the open Agent Skills standard rather than being Claude-Code-only. Intended as a pick-and-choose library rather than an all-or-nothing framework.

skillssubagentsopen-standard
by shimo4228 Aug 2, 2026 6/10
skill GitHub

claude-translation-agency: Portable Skills for Codebase and Doc Translation

A set of portable Claude Code skills plus an agent panel that translates entire projects or individual files into any language, covering codebase i18n, WordPress/gettext, and documentation. Includes adversarial QA, per-run domain specialization, and terminology research to keep translations consistent.

translationi18nskill
by roshaw Aug 2, 2026 6/10
skill GitHub

book-to-skill: Turn a Book You Own Into a Claude Skill

Converts a book you already own into a Claude skill — a short index plus one file per chapter, loaded only when needed — so an agent can reference the book's content on demand. Free, MIT-licensed, and requires no coding.

skillknowledge-baseno-code
by shaunmarsden Aug 2, 2026 6/10
skill GitHub

skill-author: Turn a Repeated Task Into a Properly Bounded Skill

Helps convert a task you keep re-prompting for into a proper Claude skill with real guardrails and stop conditions, instead of leaving it as an ad hoc one-off prompt. Free, MIT-licensed, no coding required.

skillmeta-toolingno-code
by shaunmarsden Aug 2, 2026 7/10
skill GitHub

osint-skills: 28 OSINT Agent Skills for Coding Assistants

A set of 28 open-source-intelligence skills that turn Cursor, Claude, and other AI coding agents into a research platform for reconnaissance, attribution, GEOINT, and breach checks. Described as ethical, sourced, and passive-first.

osintskillresearch
by useosint Aug 2, 2026 6/10
skill GitHub

google-slides-skill: Redesigns a Google Slides Deck and Checks Its Own Work

A Claude Code skill that redesigns a Google Slides deck to match branding you point it at, then renders every slide it touches and inspects the resulting image before calling the job done — closing the loop between editing and visual verification.

skillgoogle-slidesvisual-verification
by eranw2000 Aug 2, 2026 6/10
skill GitHub

figure-extractor: Pull Complete Figures Out of PDFs and arXiv Papers

An agent skill for Claude Code, Codex, and Kimi that extracts complete figures and images from PDF, arXiv, and HTML papers, using caption-bounding-box detection with high-DPI PyMuPDF cropping and a contact-sheet QA step to verify the crops.

skillpdfresearch-tools
by Sunrich-HT Aug 2, 2026 6/10
skill GitHub

ctx404: Durable Project Context That Survives the AI Forgetting

Stores project context in the repository itself rather than in the model's memory, so context that would otherwise be lost between Claude Code sessions persists as part of the codebase.

context-managementmemoryskill
by claudneysessa Aug 2, 2026 6/10
skill GitHub

Agent-Memory-Starter: A Memory Vault That Ships Empty on Purpose

A starter memory vault for coding agents that ships completely empty, built around the idea that the hard part of agent memory isn't storing what an agent learned — it's stopping the store from filling up with stale facts over time.

memorystarter-kitskill
by BrinShadewater Aug 2, 2026 6/10
skill GitHub

Shadewater-SEO-Skill: SEO Audits That Show Their Work

An SEO audit skill that leads with evidence and reasoning before producing fixes, aiming to give an agent implementable fixes instead of generic boilerplate advice like 'your meta description is too long.'

seoskillaudit
by BrinShadewater Aug 2, 2026 5/10
skill GitHub

claude-skills-chart-generator: Scientific Chart Generation Skill

A Claude skill for generating scientific charts — bar, line, scatter, box plot, heatmap, and more — via Python/matplotlib, aimed at papers, lab reports, and academic publications.

skilldata-visualizationmatplotlib
by Defani Aug 2, 2026 5/10
skill GitHub

second-brain-setup: Obsidian as External Memory for Claude Code

A personal knowledge management setup for Claude Code that uses an Obsidian vault as external memory, growing with every session. Ships 5 slash commands and AI-first note conventions, built on the ideas in Karpathy's LLM Knowledge Bases writeup.

obsidianmemorypkm
by dmitrax Aug 2, 2026 7/10
skill GitHub

paper-review-and-digest: Journal-Club-Style Review and Fast-Read Skills for One Paper

Two Claude Code skills for working through a single academic paper: /paper-review does a journal-club-style appraisal with a deterministic GRADE + CrossRef gate, and /paper-digest does fast content absorption. Designed to pair with separate paper-radar (discovery) and paper-fetch (download) skills.

skillacademic-papersresearch
by drpwchen Aug 2, 2026 7/10
skill GitHub

hard-won-claude-skills: 8 Skills Distilled From One Production Incident History

A set of 8 Claude Code skills distilled from a single real production project, covering verification discipline, spreadsheet (xlsx) surgery, async task UI, and more — each rule written up as having been paid for by an actual incident.

skillproduction-lessonsverification
by poloplay0114 Aug 2, 2026 7/10
skill GitHub

cloud-finops-skills: FinOps Foundation-Aligned Cost Knowledge for AI Assistants

An open-source FinOps knowledge skill and MCP covering 28 reference files across AWS/Azure/GCP/OCI cost management, AI inference economics, Kubernetes, data platforms, allocation, chargeback, anomaly management, waste detection, and GreenOps. Installs into 11 AI tools and refreshes monthly.

finopscloud-costskill
by OptimNow Aug 2, 2026 7/10
skill GitHub

capcut-agent-kit: AI agent kit for CapCut video editing

Lets an AI agent build and edit CapCut desktop projects via edit-list driven generation, including split-screen vertical layouts and surgical timeline cuts. Ships with a Claude Code skill for direct integration.

skillvideo-editingcapcut
by manproai Aug 2, 2026 6/10
skill GitHub

Pangaea Labs Claude Code plugin marketplace

A plugin marketplace bundling several Claude Code skills: docsmith (markdown to on-brand PDFs), testcraft (user flows to test-case suites), dkv (graphic-design critique with measured WCAG contrast), and production-ready Go/ElysiaJS service scaffolding. Add the marketplace once, or use the npx installer to bring any skill to any agent.

skillmarketplaceplugins
by labspangaea Aug 2, 2026 7/10
skill GitHub

ai-research-skills: SKILL.md catalog for research workflows

A universal catalog of SKILL.md files covering literature review, research design, project memory, and manuscript writing, plus cross-agent delegation patterns for Claude Code, Codex, Gemini, Cursor, and other clients. 183 stars.

skillresearchcross-agent
by WenyuChiou Aug 2, 2026 8/10
skill GitHub

wenqu-skills: Content-Creation Skill Set for AI Agents

A collection of Claude Code skills covering the full content pipeline: research/material gathering, structuring, drafting, review/optimization, and publishing. Aimed at agent-assisted writing workflows.

content-creationwritingskill-collection
by gogoingai Aug 2, 2026 5/10
skill GitHub

audit-with-plans: Consistency Auditor for planning-with-files

A companion skill to the planning-with-files methodology that checks whether code actually matches what is recorded in .planning docs, using fresh-context subagents to avoid bias from the implementing session's context.

planningauditsubagentsconsistency
by JunbaoLiang Aug 2, 2026 6/10
skill GitHub

belay: A Safety-Net Skill for Vibe Coding

A Claude Code skill styled as a climbing belay: it holds the rope while non-developers vibe code, adding guardrails intended to make AI-driven coding safer for people without a software background.

safetynon-developervibe-coding
by thanathe Aug 2, 2026 5/10
skill GitHub

claude-for-hardware: Claude Code Skills for Hardware Design

A skill set for hardware design, validation, and bring-up work with Claude Code, extending agentic coding workflows into electronics and hardware engineering tasks.

hardwarevalidationengineering
by Midstall Aug 2, 2026 6/10
skill GitHub

ux-audit-skill: 16-Dimension UX Audit Skill for Claude Code

An agent skill that audits the UX of an existing product -- website, web app, mobile, or desktop -- across 16 dimensions. Every finding is backed by evidence, a severity rating, and a confidence score.

skilluxauditdesign
by paulunemoon Aug 2, 2026 7/10
skill GitHub

Skill-Sentinel: Behavioral Scanner for Claude Skills

Sandboxes a Claude Skill and traces what it actually does at runtime rather than trusting its stated description, aimed at catching skills that behave differently from what they claim before you install them.

securityskillssandboxaudit
by handcraftedbygod Aug 2, 2026 8/10
skill GitHub

plori skills: Teach Claude Code to Drive plori Cloud Agents

Agent Skills that teach Claude Code and other coding agents to create and control plori cloud computers -- remote sandboxed environments purpose-built for AI agents to operate in.

skillcloudsandboxplori
by plori-ai Aug 2, 2026 5/10
skill GitHub

claude-quartermaster: Audit Your Entire Claude Code Setup

Audits and improves your Claude Code setup -- extensions, CLAUDE.md files, permissions, and project structure -- across every project on your machine, treating context cost as a first-class metric to optimize.

auditclaude-mdpermissionscontext-cost
by dean815 Aug 2, 2026 7/10
skill GitHub

elves: Autonomous Multi-Batch Development Skill for Claude Code and Codex

A skill that queues and runs multiple autonomous development batches across Claude Code and Codex sessions, designed to keep making progress unattended, e.g. overnight. Aimed at extending agentic coding beyond a single supervised session.

skillautonomousmulti-agentcodex
by aigorahub Aug 1, 2026 7/10
skill GitHub

personal-finance-vault-skill: Archive-First Private Finance Vault

An agent skill for building a private, machine-readable personal finance vault using deterministic parsers rather than LLM guesswork for the numbers. Takes an archive-first approach with arithmetic reconciliation and explicitly flags unknowns instead of fabricating totals.

financeskillprivacyparsing
by su7811659 Aug 1, 2026 6/10
skill GitHub

rlm-claude: Recursive Language Models Bring Infinite Memory to Claude

Brings Recursive Language Models to Claude Code as an approach to effectively infinite memory, inspired by the MIT CSAIL RLM paper. Lets the agent recursively query over context that wouldn't otherwise fit in a single window.

memoryrecursiveresearchcontext
by EncrEor Aug 1, 2026 7/10
skill GitHub

deep-research: Evidence-Driven Research Pipeline for AI Agents

deep-research decides how deep to investigate a question only after weighing the evidence, using source-grade weighted scoring and thresholds hidden from the worker doing the research, plus investigation frames tailored to the type of question. Aimed at agent research pipelines that need more rigor than a single fixed number of research phases.

researchfact-checkingagent-skills
by treylom Aug 1, 2026 6/10
skill GitHub

写作理论技能集 (Writing Theory Skill Set) for Claude Code

A Chinese-language Claude Skills collection covering adaptation workflows, original screenplay writing, novel-theory review, and performance-layer prompting. Packages established writing theory into a structured skill set aimed at turning story ideas into finished works.

creative-writingchinesescreenwritingclaude-skills
by juemin4-source Aug 1, 2026 6/10
skill GitHub

dot-claude: A Maintained Public Claude Code Config

PaulRBerg's personal Claude Code configuration, designed to be cloned directly into ~/.claude via a Just-based install flow with Bun/uv dependencies and CI. Includes a custom ccc commit wrapper and Husky/lint-staged automation — a reference for structuring a maintained Claude Code dotfiles setup.

dotfilesclaude-code-configci
by PaulRBerg Aug 1, 2026 5/10
skill GitHub

issuekit: Issue-Driven Development Skills for AI Agents

issuekit is an Agent Skills bundle that treats each GitHub issue as the canonical rich plan for a unit of work, keeping volatile specs out of the repo so only durable code gets versioned. It's Japanese-oriented: skill bodies and docs are in English, but the skills expect Japanese section headers (e.g. 受け入れ条件) hardcoded into issue bodies.

issue-trackingagent-skillsjapanese
by hirokisakabe Aug 1, 2026 6/10
skill GitHub

Winning Writing: 31 Claude Skills from a Stanford GSB Course

An agentic writing toolkit built from Glenn Kramon's Winning Writing course at Stanford GSB and Rachel Konrad's cold-outreach lectures, packaged as 31 Claude skills. Includes a browser-based Coach with span-level inline critique and a refinement chat, plus a Chrome MV3 extension that runs the same critic inside the Gmail side panel.

writingclaude-skillschrome-extensionstanford-gsb
by kalyvask Aug 1, 2026 8/10
skill GitHub

k-fable-opus-claude-md: A Token-Lean CLAUDE.md Tuned for Opus 4.8

A CLAUDE.md configuration rewritten to cut token usage for Opus 4.8, built after the author was surprised by how many tokens Fable 5 was burning. Korean-language, but a useful reference for anyone trying to trim their own CLAUDE.md.

claude-mdtoken-optimizationopusfable
by habinsong Aug 1, 2026 5/10
skill GitHub

socratic: 697 Questions a Senior Engineer Asks Before Writing Code

Packages a senior engineer's pre-coding question checklist — 697 questions — as a Claude/Codex skill and a portable prompt, meant to catch design and edge-case gaps before implementation starts.

code-reviewchecklistcodexdesign
by m4vic Aug 1, 2026 7/10
skill GitHub

ultra11y: WCAG 2.2 AA Accessibility Audits With Anti-Hallucination Gates

Audits HTML/CSS/JSX against WCAG 2.2 AA and produces a dated compliance report, combining a zero-dependency static engine with agent judgment plus check/verify gates to catch hallucinated findings. Also usable to author or review accessible markup directly.

accessibilitywcagauditanti-hallucination
by maxgfr Aug 1, 2026 6/10
skill GitHub

salesforce-core-skills: Eleven Claude Skills for Salesforce Admin and Dev Work

Eleven general-purpose Salesforce skills — Apex, Flow, SOQL/Data, LWC, Metadata, Permissions, Diagrams, Org Audit, Tests, Security, and Debug — that work with any Salesforce MCP server. Installable as a Claude Desktop/Cowork plugin marketplace.

salesforceapexsoqlenterprise
by kugamon Aug 1, 2026 7/10
skill GitHub

system-analyst-skill: Markdown-to-PDF/DOCX With Mermaid Rendering

A system-analysis skill set (SRS, use cases, data dictionaries, architecture, RTM) built for a Thai-language project, paired with an md-to-docs converter that renders Mermaid diagrams into PDF/DOCX with Thai-language support.

documentationmermaidmarkdownthai
by UMIN1703 Aug 1, 2026 5/10
skill GitHub

eu-ai-act-skill: An EU AI Act Compliance Advisor Skill

A Claude skill covering EU AI Act Article 50 labeling duties, all exemptions, a no-label decision playbook, and DACH-specific Abmahnung (warning-letter) risk — first release in a planned AI governance skill family.

complianceeu-ai-actlegalgovernance
by dankofly Aug 1, 2026 6/10
skill GitHub

bullshit-detector: Claim-by-Claim Fact-Checking With a 0-10 BS Score

Fact-checks any YouTube video, article, tweet, or PDF claim by claim, citing sources and producing a 0-10 "BS score" — a skill for quickly sanity-checking content before trusting or sharing it.

fact-checkingverificationcontent-analysis
by SerhiiKorniienko Aug 1, 2026 7/10
skill GitHub

claude-compass: A Job-Search Plugin Pack for Visa-Sponsorship Countries

Slash commands for Claude Cowork that help IT/tech job seekers find visa-sponsorship and remote-hire countries, calculate realistic salaries, locate verified job portals, and screen job descriptions against a resume — grounded in real listings rather than guesses.

job-searchvisasalarycowork
by myowinthein Aug 1, 2026 5/10
skill GitHub

redact-pii-skill: A Reusable Skill for Redacting PII From Text

Identifies and redacts personally identifiable information in text — a drop-in skill for agents that need to scrub sensitive data before it's logged, shared, or sent to a model.

piiredactionprivacy
by scholarly360 Aug 1, 2026 5/10
skill GitHub

docs-skills: AI Agent Skills for Documentation Analysis

A collection of agent skills focused on analyzing documentation, compatible with Claude Code, Cursor, Codex, and Copilot. Helps agents review and reason about docs across multiple coding-agent hosts.

documentationskillsmulti-agentanalysis
by Docsbook-io Aug 1, 2026 6/10
skill GitHub

folder-structure-protocol: Skills for Evaluating Folder Architecture

Claude skills for auditing folder and project architecture and running staged AI workflows, built on a five-layer context hierarchy (ICM). Helps agents reason about codebase organization before making changes.

architecturefolder-structurecontextskills
by mcmespinaa Aug 1, 2026 5/10
skill GitHub

wilbeibi-skills: 16 Agent Skills for Claude Code and Codex

A skill pack covering code review, test writing, docs, planning, codebase onboarding, repo evaluation, paper search, and Obsidian capture/search. Installable via npx skills.

skillscode-reviewonboardingobsidian
by wilbeibi Aug 1, 2026 6/10
skill GitHub

How One Founder Runs a B2B GTM Function on Claude Code

A sanitized writeup of a real production setup: 14 skills, 4 MCP servers, and 14 scheduled agents running a B2B go-to-market function, including the memory layer and cron scheduling architecture.

gtmskillsmcpscheduled-agents
by romanmagdalenko Aug 1, 2026 7/10
skill GitHub

writer: Anti-Neuroslop Prose Editor Skill for RU/EN

A Claude Code skill that edits prose to strip AI-sounding patterns in Russian and English, organized into 23 rewrite categories with structural rewriting rules and an offline linter.

writingeditingrussian
by Mikefluff Aug 1, 2026 5/10
skill Reddit

brass-tacks: A Claude Code Skill to Cut Opus/Fable 5 Verbosity

Forces Claude to lead with the actual next step instead of preamble, breaks multi-step work into numbered bite-sized actions, and cuts filler like 'let me know if you need anything else.' Calibrated to explain jargon on first use without over-explaining basics. Toggle on with /brass-tacks, off by saying so.

skillconcisenessverbosity
by SkytheWitcher Aug 1, 2026 7/10
skill GitHub

billow: Self-Hosted Next.js App Foundation With Claude Code Release Skills

A self-hosted app foundation for Next.js with Better Auth, Prisma/Postgres, multi-arch Docker releases, and health diagnostics — tuned for Umbrel but runs anywhere Docker does. Ships Claude Code skills for handling releases and issues.

nextjsself-hosteddockerskills
by chepetime Aug 1, 2026 5/10
skill GitHub

property-deep-dive: Pre-Purchase Property Due-Diligence Skill for 126 Countries

A large Claude skill covering property due diligence across 126 countries with 41 invocable sections plus cross-cutting layers for tax, visas, mortgages, scams, and title-fraud monitoring. Every claim is sourced from primary government data, dated, and confidence-labeled.

skillreal-estatedue-diligence
by soreavis Aug 1, 2026 5/10
skill GitHub

my-llm-kit: A Personal, Versioned Claude Code Setup

One author's versioned personal Claude Code setup: a writing system (unslop), a research system, a global CLAUDE.md, and a single idempotent install script.

personal-setupclaude.mdwriting
by badmuriss Aug 1, 2026 5/10
skill GitHub

rig: A Multi-Agent Harness Packaged as a Skill

A multi-agent coding harness from GitHub Next, packaged as an installable Skill rather than a standalone tool.

multi-agentgithub-nextskill
by githubnext Aug 1, 2026 7/10
skill Reddit

697 Questions a Senior Engineer Asks Before Writing Code (Claude/Codex Skill)

A Socratic pre-coding checklist packaged as a Claude/Codex skill and portable prompt, designed to make the agent interrogate requirements and edge cases before writing any code rather than after. Aimed at teams wanting more upfront rigor than a quick one-shot implementation.

skillsocraticrequirementsplanning
by AffectionateSport135 Jul 31, 2026 6/10
skill Reddit

Dip-dip-dip-dip: Turns a GitHub PR Review Into 19th-Century Correspondence

A novelty Claude Code skill that rewrites PR review requests as ornate 19th-century letters, inspired by a Family Guy bit. A lighthearted example of using skills for tone and style transformation rather than pure productivity.

skillnoveltyhumorpr-review
by schrodingershit Jul 31, 2026 5/10
skill Reddit

feature-recon: multi-lens Claude Code plugin for codebase audits

A Claude Code plugin that sweeps your codebase through four lenses -- Product Engineer, UI/UX, Security, and QA -- producing JSON and HTML reports with charts. Includes a helper command to turn findings into task documents for follow-up work.

plugincode-reviewqasecurityaudit
by iSerter Jul 31, 2026 7/10
skill GitHub

Solana Skills: Claude Code plugin marketplace for DeFi agents

An open marketplace of Claude Code skills for Solana development, covering DeFi protocols (Jupiter, Kamino, Raydium), infrastructure (Helius, QuickNode), and more. Install via /plugin marketplace add; skills auto-activate based on context.

solanadefiblockchainmarketplaceskill
by sendaifun Jul 31, 2026 6/10
skill GitHub

naver-ads-expert: RAG-grounded Claude Skill for Naver Ads

A Claude Skill that turns an AI agent into a Naver Ads expert, grounded in all 1,148 official Naver Advertiser Center help documents with zero-dependency local search. Installable as a Claude Code plugin in two lines.

skillragkoreanadvertisingplugin
by JaceProgramming Jul 31, 2026 6/10
skill GitHub

Bilingual Annotator Toolkit: Dual-Column Translation Study Pages

A set of Claude Skills that turns any text into a color-coded, dual-column HTML page with side-by-side translation and structural analysis. Includes interactive study-visual generators, aimed at language learners and bilingual readers.

skilltranslationlanguage-learninghtml
by si-kui-a Jul 31, 2026 5/10
skill GitHub

iOS Architecture Expert Skill: Clean Architecture for Swift 6

A Claude Code Agent Skill for building modular, testable iOS apps using composition roots, protocol boundaries, and generic presenters. Targets Swift 6 concurrency patterns for clean architecture.

skilliosswiftarchitecture
by SwiftyJourney Jul 31, 2026 6/10
skill GitHub

Architecture Drawer: Text-to-Editable PowerPoint Diagrams

A skill for Claude Code and Codex that turns a text description of a system architecture into an editable PowerPoint diagram with native shapes, rather than a flat image export.

skilldiagramspowerpointarchitecture
by Andy1314Chen Jul 31, 2026 6/10
skill Reddit

SuperCMO: Open-Source AI Agent Skills for Creative Campaigns

A chain of Agent Skills that plans, generates, edits, and ships full creative campaigns (UGC video, product launches, content) using your own API keys. Routes each step to the right image, video, or audio model and includes a dry-run cost preview; works in Claude Code, Cursor, Codex, and other Agent-Skills-compatible tools.

skillmarketingcreativemedia-generation
by Key_Significance1880 Jul 31, 2026 6/10
skill GitHub

Claude Code <-> Codex Collaboration Skill

A global Claude Code skill enabling reliable collaboration with OpenAI Codex through MCP, for teams or individuals mixing both agents in one workflow.

skillcodexmcpmulti-agent
by iajihga Jul 31, 2026 6/10
skill GitHub

Book Capsule: One-Click Book Summary Cards (Chinese)

A Claude Skill that condenses a book into a card-style HTML summary, running entirely locally with no dependencies. Aimed at Chinese-language readers who want quick, shareable book digests.

skillsummarizationhtmlchinese
by zhouq2039-lang Jul 31, 2026 5/10
skill GitHub

ci-speedup: Audit Why Your GitHub Actions CI Is Slow

A free, MIT-licensed agent skill from StarSling that analyzes real GitHub Actions run history and reports concretely why CI is slow, rather than giving generic advice.

skillci-cdgithub-actionsperformance
by starslingdev Jul 31, 2026 6/10
skill GitHub

godplans: Emit a Complete Master Plan Before Any Code Is Written

A single-command Agent Skill that produces a complete, audit-proof, agent-executable master plan (PLAN.mdx) before implementation starts. Works across Claude Code, Codex, Cursor, OpenCode, and other Agent Skills clients.

skillplanningworkflow
by hannsxpeter Jul 31, 2026 5/10
skill GitHub

claude-code-skill-creator: Measure Whether Your Skills Actually Help

A rewritten derivative of Anthropic's skill-creator that adds trustworthy measurement of whether a skill actually improves outcomes: no silent zeros, one canonical workspace layout, target-aware validation, and 574 tests.

skillskill-creatortestingmeta
by OpenCnid Jul 31, 2026 7/10
skill GitHub

crun-agent-skills: Route Media Generation Across 138 Models

Agent skills that route, estimate cost for, create, and retrieve image, video, speech, and music generation across 138 models via the Crun API. Works with Claude Code, Codex, Cursor, and any SKILL.md-compatible platform.

skillmedia-generationapi
by Sean190828 Jul 31, 2026 6/10
skill GitHub

Bouncer: 13-Check Security Scanner for AI-Built Prototype Apps

A Claude Agent Skill that audits AI-built and prototype apps before real users see them, running 13 checks for exposed secrets, open databases, and missing auth, aimed at the common failure mode of vibe-coded apps shipping with basic security holes.

skillsecurityaudit
by punitsnaik Jul 31, 2026 7/10
skill GitHub

GA4 Analytics Data Quality Suite: Enterprise Tracking Plan Auditor

A GA4 tracking-plan auditor and UTM taxonomy enforcer built with custom Claude Agent Skills and Python, automatically catching schema drift, nested-parameter errors, and attribution breaks.

skillanalyticsga4
by samikshapattanaik-cmyk Jul 31, 2026 5/10
skill Reddit

7 Skill Improvements Learned the Hard Way

Practical lessons from building Claude Code Skills: ask clarifying questions before starting, add a verification step, use SKILL.md as a router to lazy-load resources, write triggering descriptions, promote proven skills to personal/plugin scope, pick the cheapest adequate model, and delegate context-heavy work to a sub-agent.

skillbest-practicestips
by Dear-Mix7726 Jul 31, 2026 6/10
skill GitHub

prompt-workflow-architecture: Turn a Rough Idea Into a Structured Prompt

A Claude Code skill that interviews you to convert a rough task idea into a high-level prompt with explicit outcome, guardrails, and self-verification, then picks the right execution mode: single agent, workflow, loop, or routine.

skillpromptingworkflow-design
by promptmetrics Jul 31, 2026 6/10
skill GitHub

plain-ko: A Korean Tech-Writing Rhetoric Linter

A Claude Code skill that flags excessive Sino-Korean abstract vocabulary and rhetorical padding in Korean technical writing, suggesting concrete alternatives, and grows its own dictionary from your git correction history over time.

skillkoreanwritinglinter
by IMMINJU Jul 31, 2026 6/10
skill GitHub

multi-agent-delegation: stop silent no-op failures in subagent handoffs

An agent skill for Claude Code and Codex that prevents subagents from silently failing to do the work they were delegated. It enforces mandatory prompt clauses, verifies artifacts actually exist after delegation, supports resume-based recovery, and uses a ledger-as-spec approach for parallel delegation.

skillsubagentsdelegationverification
by h8nc4y Jul 31, 2026 6/10
skill GitHub

india-itr-skills: Claude Code skills for filing Indian income-tax returns

A set of Claude Code skills for filing ITR-1 and ITR-2 Indian income tax returns, covering AIS/TIS/26AS reconciliation, Schedule AL, Schedule 112A CSV generation, and end-to-end portal filing, distilled from the author's real filings.

taxindiadomain-skill
by ankitkr Jul 31, 2026 6/10
skill GitHub

sdd-skills: spec-driven development skills with contract-based auto-fix

Claude Code skills implementing spec-driven development: turning a PRD into a spec/contract, implementing against it, then running contract-based evaluation with automatic fixes when the implementation drifts from the contract.

spec-drivenskillcontracts
by dayvisonassis Jul 31, 2026 6/10
skill GitHub

claude-dataroom-prep: structure messy folders into M&A-ready datarooms

A Claude Code skill that classifies, deduplicates, and version-detects files in a messy folder to build an M&A-ready dataroom, including a contextual missing-documents checklist. Supports French, English, German, Italian, and Spanish.

m&adocument-managementskillmultilingual
by Hectelion-SA Jul 31, 2026 6/10
skill GitHub

cc-delegate: WorkBuddy Skill for Reliably Delegating Long Tasks to Local Claude Code

A Claude Code skill that uses claude-code-mcp with stateful --resume to hand off long-running tasks to a local Claude Code instance without losing context. Supports cross-call handoff so work can be picked back up across multiple invocations without re-explaining state.

skillmcptask-delegation
by gugug168 Jul 30, 2026 6/10
skill GitHub

codex-image-skill: Image Generation/Editing via Codex CLI with Pin-Comment Review Loop

A Claude Code skill that generates and edits images using Codex CLI's gpt-image-2 model, with a pin-comment review loop for iterative feedback and a CJK label overlay pipeline. Useful for teams needing AI-generated imagery with localized text overlays reviewed in-context.

skillimage-generationcodex
by bbiyakfather Jul 30, 2026 6/10
skill GitHub

slop-metrics: Score Your Codebase for AI Slop Against SlopCodeBench Baselines

An agent skill that scores any codebase for slop (structural erosion and verbosity) and compares the result against SlopCodeBench's published human and agent baselines, giving a benchmarked way to judge whether AI-assisted code is degrading in quality.

skillcode-quality
by dontbanmeplz Jul 30, 2026 5/10
skill GitHub

Cambrian: Claude Code Plugin for Generating Diverse, Non-Cliche Ideas from a Brief

A domain-agnostic Claude Code plugin that generates varied ideas from any brief by combining blind variation, MAP-Elites, novelty search, DPP selection, and human guidance, without needing extra LLM API keys. Aims to avoid the generic ideas plain LLM brainstorming tends to produce.

skillideationplugin
by sergiparpal Jul 30, 2026 7/10
skill GitHub

ux-proofsheet: Benchmark a UI/UX Design Against How Real Apps Ship

A Claude Agent Skill that benchmarks a UI/UX design against how comparable real apps actually ship, both within your industry and outside it, giving concrete precedent-based feedback instead of generic design critique.

skillux-design
by mananritwik Jul 30, 2026 6/10
skill GitHub

ENLOOP.Skill: Self-Grading Prompt Refinement Loop with a Bounded Stop Condition

A Claude Skill that rewrites your prompt, runs it, and grades the result against its own success criteria in one turn. The loop is bounded to a max of 2 refine passes, with a separate stop condition and a no-progress halt to prevent runaway iteration.

skillself-refinement
by keymessagesstudio-design Jul 30, 2026 6/10
skill GitHub

visual-vibes: Evidence-Backed Architecture Diagrams as a Claude Skill

A Claude Agent Skill that builds one grounded model of a repository and renders it as consistent C4, UML, ERD, DFD, sequence, deployment, and security diagrams using Mermaid and draw.io. Keeps diagrams evidence-backed and consistent across views instead of hand-drawn and drifting from the code.

architecture-diagramsmermaiddocumentation
by yash0208 Jul 30, 2026 7/10
skill GitHub

Five Claude Skills for Humanities Students (Law, History, Lit, More)

A set of five ready-made Claude Skills for students in close-reading, argument, and citation-heavy fields: law, political science, history, sociology, and literature. No programming knowledge needed to install or use them, bringing Claude Code-style tooling to non-technical disciplines.

humanitieseducationnon-coding
by Poisoneddiety Jul 30, 2026 5/10
skill GitHub

exceptd-skills: AI Security Skills Grounded in 2026 Threat Reality

A collection of security-focused Claude Skills built around current (mid-2026) threat patterns rather than stale framework documentation. Aims to keep security guidance for AI-assisted development up to date as the threat landscape shifts.

securityskillsthreat-modeling
by blamejs Jul 30, 2026 6/10
skill GitHub

feature-map: Business-Flow Memory That Audits Cross-Layer Drift

Maintains a FEATURE-MAP.yaml registry that tracks how features touch client, backend, admin, and docs layers, then audits drift between them as GAP/DRIFT/IMPACT/OK. Ships as both a Claude Code plugin and a Codex skill, helping agents keep cross-layer changes in sync instead of silently diverging.

drift-detectionplugincodebase-mapping
by ade-syofyan Jul 30, 2026 7/10
skill GitHub

sai-poster-studio: Describe a Poster in English, Get Print-Ready Art

A local studio plus a keyless Claude Skill that turns a plain-English description into a finished, on-brand poster as print-ready PNG or SVG. Useful for quick promotional or event graphics without opening a design tool.

poster-designgraphicslocal-studio
by wyuee912-ops Jul 30, 2026 6/10
skill GitHub

launchworthy: Production Readiness Audits for AI-Built Apps

A Claude Code skill that audits AI-built apps (from Lovable, Bolt, v0, Cursor, and similar builders) across five production-readiness domains and returns a scored punch list with copy-paste fixes. MIT licensed; targets apps built across multiple AI builders rather than one specific stack.

production-readinessauditmit-license
by Wunderlandmedia Jul 30, 2026 6/10
skill GitHub

skill-interviewer: Turn Expert Interviews into Portable AI Skills

Runs structured interviews with a domain expert to extract tacit judgment, workflows, exceptions, and acceptance criteria, then compiles the result into a portable AI skill usable by Claude and Codex. A meta-tool for capturing expertise that would otherwise stay undocumented.

skill-authoringexpert-knowledgemeta-tool
by eritowu Jul 30, 2026 7/10
skill GitHub

video-to-skill: Turn Videos and Courses into Grounded Agent Skills

Converts videos and course material into evidence-grounded Agent Skills for Claude Code and Codex, extracting procedural knowledge from video content instead of requiring it to be written up by hand. Extends the video-to-skill idea to full courses, not just single videos.

skill-authoringvideoeducation
by Lum1104 Jul 30, 2026 6/10
skill GitHub

Univer Skill: Git-Style Diffs and Review for AI Spreadsheet Edits

A Claude Skill (and CLI) that lets AI tools work directly with spreadsheets, Excel workbooks, and CSV files, adding Git-style diffs, reviews, approvals, and rollbacks to spreadsheet edits. Makes human-AI collaboration on spreadsheets structured and reviewable instead of a black box.

spreadsheetsgit-diffexcel
by dream-num Jul 30, 2026 7/10
skill GitHub

bochi: Idea Expansion Skill Using Socratic Questioning and SCAMPER

A Claude Code skill that transforms a raw idea seed into structured hypotheses through Socratic questioning, SCAMPER, ReAct-style research, E-E-A-T scoring, and first-principles critique. Useful for turning a vague idea into something rigorously examined before committing time to it.

ideationsocratic-methodresearch
by fideguch Jul 30, 2026 7/10
skill GitHub

plain-language-skill: Write Documents to the ISO 24495-1 Standard

An agent skill that writes documents conforming to ISO 24495-1:2023, the international Plain Language standard. Works with Claude Code, Cursor, Codex, and any harness that supports the Agent Skills standard, useful for anyone who needs clear, accessible writing output by default.

plain-languagewritingiso-standard
by nikdumroese Jul 30, 2026 6/10
skill GitHub

token-optimiser: Pick Model, Surface, and Budget Before You Run

A Claude skill that routes a task before execution, surfacing the right model choice, interface, and token budget in one card. Aimed at spending tokens deliberately rather than defaulting to the most expensive model for every task.

token-optimizationroutingcost-control
by jamiecooper4-netizen Jul 30, 2026 6/10
skill GitHub

Context-Engineering: Repo Skeleton and Skills to Audit CLAUDE.md

A context-engineering standard for Claude Code combining distilled Anthropic guidance, a replicable repo skeleton, and skills that install and audit adherence to it. One of several context-engineering entries in this space, focused specifically on installable and auditable structure rather than token reduction.

context-engineeringclaude-mdaudit
by BriarDevv Jul 30, 2026 5/10
skill GitHub

dev-toolkit: Platform Engineering Kit of Actions, Skills, and Configs

A platform-engineering toolkit bundling reusable GitHub Actions, AI Skills, and shared TypeScript configs. A grab-bag utility repo useful mainly to teams standardizing tooling across multiple projects.

platform-engineeringgithub-actionstypescript
by kin0992 Jul 30, 2026 5/10
skill GitHub

Plugins-Weave: 7-Plugin Claude Code Marketplace incl. Hierarchical RAG Memory

A Claude Code plugin marketplace offering seven plugins: ContextPreloader (initial context loading), EpisodicRAG (hierarchical long-term memory), EmailingEssay (AI-driven essay delivery), VisualExpression (expression layer), EmotionPulse (emotion indicator), TelegramSecretary (serverless AI secretary), and ConsiderateCoder (AI-delegated development). A varied, personality-driven plugin set built around an assistant persona.

plugin-marketplacerag-memorypersona
by Bizuayeu Jul 30, 2026 6/10
skill GitHub

MyR2D2: Astromech-Droid Claude Code Skillset (zh-TW, Bilingual)

A Claude Code skillset styled as a personal astromech droid assistant, with bilingual Traditional Chinese/English triggers. A fun, persona-driven skill pack aimed at Traditional Chinese-speaking users.

personabilingualzh-tw
by tingyulu Jul 30, 2026 5/10
skill GitHub

dotnet-lean-arch-skill: Pragmatic Clean Architecture for .NET

An Agent Skill that packages a pragmatic Clean Architecture approach for .NET backends. Gives Claude Code a consistent structural pattern to follow when scaffolding or reviewing .NET services.

dotnetclean-architecturebackend
by jbrambilla Jul 30, 2026 5/10
skill GitHub

Apiiro Security Plugins for Claude Code and Cursor

Official security plugins from Apiiro adding secrets detection, threat modeling, and prompt enrichment to Claude Code and Cursor. Brings enterprise application-security tooling directly into the agent workflow.

securitysecrets-detectionthreat-modeling
by apiiro Jul 30, 2026 7/10
skill GitHub

Google AppSheet Agent Skill with Doc Grounding and Security Gates

A production-ready Agent Skill for building on Google AppSheet, grounded in official documentation with built-in security gates, templates, and validation helpers. Reduces hallucinated AppSheet APIs when an agent scaffolds an app.

appsheetgooglelow-code
by Yash-Kavaiya Jul 30, 2026 6/10
skill GitHub

degardis-skills: Production-Ready Skills for Common Dev Workflows

A curated collection of AI agent skills covering bug fixing, code review, testing, refactoring, documentation, dependency upgrades, performance optimization, feature implementation, and tech migration. Authored with the Degardis toolset.

skillsdev-workflowtestingrefactoring
by Khojasteh Jul 30, 2026 6/10
skill GitHub

claude-skills-templates: Five Reference SKILL.md Patterns

Five production-ready Claude Skill templates, a one-pager writer, code reviewer, brand voice keeper, CSV cleaner, and decision-doc generator, each demonstrating a different SKILL.md pattern. MIT licensed and drops into Claude Code or Claude.ai.

skill-templatesexamplesmit-license
by 0xelitesystem Jul 30, 2026 7/10
skill GitHub

Claude Code Power Pack Lite: CLAUDE.md Template and TDD/PR-Ship Skills

The free lite edition of the Claude Code Power Pack, bundling an engineering-grade CLAUDE.md template, TDD and PR-ship skills, and a balanced permission preset. Bilingual English/Chinese documentation.

claude-mdtddpermissionsskills
by huangxiaojian Jul 30, 2026 6/10
skill GitHub

s3-temp-share: Agent Skill for Expiring S3/R2 File Links

An Agent Skill and CLI for sharing files privately via temporary, expiring S3 or Cloudflare R2 URLs. Lets an agent generate a short-lived shareable link instead of exposing a permanently public bucket.

s3r2file-sharingcli
by jweaker Jul 30, 2026 6/10
skill GitHub

seo-client-report-skill: Automated Branded SEO Client Reports

A Claude Code / Codex skill that turns Search Console, GA4, and rank-tracker exports into a branded, live monthly SEO client report using a consistent template with no fabricated metrics. Publishes the report via the ReportRoom MCP.

seoreportingautomation
by dashaworks Jul 30, 2026 6/10
skill GitHub

share-as-link-skill: Turn Any AI Output into a Live Public Link

A Claude Code / Codex skill that converts any chat reply, artifact, or markdown output into a live public URL in about 10 seconds, with view-count tracking. A lightweight DocSend-style alternative for quick sharing, published via the ReportRoom MCP.

sharingpublishingtracking
by dashaworks Jul 30, 2026 6/10
skill GitHub

data-room-skill: Build a Due-Diligence Data Room from Your Agent Session

A Claude Code / Codex skill for building an M&A or fundraising due-diligence data room, with email/passcode/allowlist access, NDA gating, expiry, instant revoke, and per-viewer analytics. Runs on the ReportRoom MCP's paid Business plan.

data-roomfundraisingdue-diligence
by dashaworks Jul 30, 2026 5/10
skill GitHub

AlemTuzlak/skills: Turn a PR or Idea into Marketing Content and Videos

Personal agent skills for Claude Code, Copilot, Codex, Gemini, and Cursor that turn a pull request or idea into marketing copy, technical Slidev presentations, courses, changelogs, and rendered videos. Useful for developers who need to communicate technical work to a broader audience.

marketingslidevvideochangelog
by AlemTuzlak Jul 30, 2026 6/10
skill GitHub

A 20-Plugin, 160-Skill Multi-Harness Marketplace

A public marketplace bundling 20 plugins and 160 skills for Claude Code, Claude Cowork, and Codex. One of the larger community skill/plugin collections available for quick installation.

marketplacepluginsskills
by Israelmusondaayliffe Jul 30, 2026 5/10
skill GitHub

amlei-resume: End-to-End Resume-Building Agent Skill

An Agent Skill (agentskills.io spec) that walks you through building a resume from raw material to a finished A4 PDF, including role-targeted rewrites and outreach messages for job platforms. Compatible with Claude Code, Cursor, Codex, and other agent runtimes.

resumecareerpdf
by amlei Jul 30, 2026 5/10
skill GitHub

aiv-mini-audit: Free Claude Skill for AI Visibility Audits

A free Claude skill that checks whether AI assistants mention your business when a buyer asks for a recommendation, an early take on AI visibility auditing. Useful for businesses trying to understand how they show up in AI-generated answers.

seoai-visibilityaudit
by autojate Jul 30, 2026 6/10
skill GitHub

skills: Cross-Agent Skill Collection for Claude Code, Cursor & Codex

A collection of agent skills installable via npx skills add stewartcelani/skills, compatible with Claude Code, Cursor, Codex, and similar coding agents. Provides a quick way to pull in a curated skill set without manual setup.

skillscross-agentinstaller
by stewartcelani Jul 30, 2026 5/10
skill GitHub

distro-skills: Agent Skills for Launching Dev Products

Agent Skills that automate distributing developer and indie products across Show HN, Product Hunt, awesome-lists, dev.to, GitHub, Reddit, X, and npm/PyPI. Positioned as the release/marketing counterpart to build-focused skills.

skillsmarketinglaunchdistribution
by royalpinto007 Jul 30, 2026 6/10
skill Reddit

memU: Mines Claude Code Session Logs into Persistent Memory

An open-source (Apache-2.0) memory skill that installs itself by having Claude Code fetch its SKILL.md, then mines your session transcripts into editable memory files and patches your setup to retrieve relevant memories before answering. Aimed at replacing a hand-maintained CLAUDE.md that has grown into a stale junk drawer of half-remembered rules.

memoryskillsession-logsopen-source
by AcanthisittaOk1699 Jul 30, 2026 7/10
skill GitHub

agent-workspace: lifecycle skills for agent workspace hygiene

A set of lifecycle skills that give a coding agent a persistent sense of where a project stands across sessions — tracking state, decisions, and next steps as ongoing workspace memory and hygiene.

skillmemoryworkspace-hygiene
by conorbronsdon Jul 30, 2026 6/10
skill GitHub

agent-skill-builder: a skill that builds skills — with drift validation

A skill that scaffolds new agent skills with spec-current frontmatter, paired with a validator that fails the build when a skill's structure drifts out of spec. Aims to keep a growing skill library consistent instead of rotting over time.

skillvalidatormeta
by conorbronsdon Jul 30, 2026 6/10
skill GitHub

skill-matting: AI background removal for images and video

A Claude Code skill for AI-powered image and video background removal using the BiRefNet GGUF model, outputting transparent PNG, MOV, or WebM. Useful for quickly matting assets without leaving the agent workflow.

skillimage-processingvideomatting
by xiaowu89 Jul 30, 2026 5/10
skill GitHub

rote: compile agent skills into deterministic, LLM-free pipelines

Compiles AI agent skills into cheap, fast, deterministic pipelines that run without an LLM in the loop once compiled. Useful for turning a skill you've validated with an agent into a repeatable script that doesn't need inference to execute.

skilldeterminismpipeline
by trevhud Jul 30, 2026 6/10
skill GitHub

conversation-digest: turn long threads into a decision-ready digest

A Claude Code skill that condenses long Slack threads, tickets, incident logs, and announcements into a decision-ready digest plus a clear list of what you personally need to do next. Available in Vietnamese and English.

skillsummarizationslackdigest
by Rayloveyou Jul 30, 2026 6/10
skill GitHub

handover: a disposable end-of-session handover skill

A Claude Code skill for tight, disposable end-of-session handovers: it routes durable facts to permanent memory stores and keeps only what the next session actually needs to resume, instead of dumping the whole transcript.

skillmemorysession-handover
by ami-bu Jul 30, 2026 7/10
skill GitHub

academic-homepage-cv-sync: Keep Your Website and LaTeX CV in Sync

A YAML-based maintenance kit for academic homepages: one script regenerates a Jekyll website and a LaTeX CV from the same source data, so the two can never drift apart. Ships with a CLAUDE.md that teaches Claude Code the update workflow, so adding a new paper is as simple as asking the agent to add it.

claude-mdtemplateacademicautomation
by kw1jjang Jul 30, 2026 5/10
skill GitHub

pmm-os: 45 Product Marketing and GTM Skills for the Terminal

A skill pack covering product marketing and go-to-market work directly from the terminal: positioning, messaging, personas, pricing, battlecards, and launches, plus an interactive launch kit. Built for Claude Code and Codex.

marketinggtmskill-pack
by buildingwithai Jul 30, 2026 5/10
skill GitHub

novel-to-game: A 7-Skill Pipeline That Turns a Story Into a Playable Game

Adapts any novel or story into a playable game through a 7-skill pipeline, distilling narrative into game mechanics and content rather than just generating a generic game shell. Built for Claude Code, Codex, and Kimi Code.

game-devnarrativeskill-pipeline
by worldwonderer Jul 30, 2026 6/10
skill GitHub

Kudosity Skills: Send SMS, MMS, WhatsApp, and RCS from Any Agent

Agent skills for the Kudosity messaging platform, letting Claude Code, Cursor, Copilot, Windsurf, or any SKILL.md-reading agent send SMS, MMS, WhatsApp, and RCS messages. A vendor-specific messaging integration for agents that need to notify or reach users directly.

messagingsmswhatsappintegration
by kudosity Jul 30, 2026 5/10
skill GitHub

ui-ux-laws: A Claude Code Skill That Enforces UI/UX Best Practices

Packages priority-ordered UI/UX laws, cognitive-psychology principles, Nielsen heuristics, and accessibility non-negotiables into a Claude Code skill. The model actively checks and enforces these rules on its own generated UI output rather than just referencing them as documentation.

ui-uxaccessibilitydesignskill
by AmirGhl Jul 30, 2026 6/10
skill Reddit

/call-me: Let Your Claude Agent Call Your iPhone (Free)

A Claude Code skill plus companion iPhone app that lets your agent place a phone call to you when it needs input, using internal iPhone APIs so there are no external calling fees. Aimed at long-running tasks, scheduled jobs, and cron sessions where you might not check chat for hours.

notificationsiphonehuman-in-the-loopskill
by radressss Jul 30, 2026 6/10
skill GitHub

devops-skills: Multi-Tool DevOps Skills for Claude Code, Cursor, and Codex

Covers Terraform, Kubernetes, Docker, GitHub Actions, GitLab CI, AWS FinOps, and OWASP security as skills usable across Claude Code, Cursor, and Codex. A broad DevOps skill pack rather than a single-tool integration.

devopsterraformkubernetessecurity
by anmolnagpal Jul 30, 2026 6/10
skill GitHub

firma: Anti-Slop Design Skill for Spanish-Speaking Coding Agents

A design skill built for developers who ship in Spanish ("quienes shippean en espanol"), enforcing voseo language conventions, treating honesty as a hard rule, and rotating memory between builds to avoid design drift. Fills a gap for non-English-first Claude Code skill packs.

spanishdesignanti-sloplocalization
by stgomoyaa Jul 30, 2026 5/10
skill GitHub

duet: Reflection, Writing, and Design Skills for Claude Code

A Claude Code plugin bundling slash commands, agents, and workflow tools centered on reflection, writing, and design work rather than pure coding tasks. Installs as a standard plugin under the Claude Code plugins directory.

writingreflectionplugin
by tslateman Jul 30, 2026 5/10
skill GitHub

AgentAlertsSkill: iPhone Live Activity and Notification Alerts for Coding Agents

A Codex/Claude skill that sets up automations pushing iPhone Live Activity, widget, notification, and Control Widget updates directly from your agent session. Lets you glance at your lock screen or Dynamic Island to see agent status instead of checking a terminal.

iphonelive-activitynotificationsskill
by AndreasInk Jul 30, 2026 6/10
skill Reddit

Sol-skill: Fable 5 as orchestrator, Sol 5.6 as worker

A Claude Code skill/plugin that lets Fable 5 hand off implementation tasks to Sol as a worker model, then reviews the results afterward to save tokens. Installable via plugin marketplace; supports both implementation and research delegation commands.

skillorchestrationmulti-modelplugin
by kasikciozan Jul 29, 2026 6/10
skill GitHub

agent-skills: laravel-filament skill for Claude Code

A version-aware Claude Code skill covering Laravel Filament best practices across versions 1 through 5, including upgrade guides — useful for teams maintaining Filament admin panels across version bumps.

skilllaravelfilamentphp
by majdghithan Jul 29, 2026 5/10
skill Reddit

A CLAUDE.md emphasizing terse final replies and mandatory fact-checking

A shared global CLAUDE.md focused on response style (match length to task, no play-by-play narration, structured root-cause/fix/verification summaries for debugging), code quality defaults (root-cause fixes, appropriate data structures, unsolicited error handling where needed), and a fact-checking policy that bans citing external numbers from memory and requires labeling claims as verified/recalled/inferred.

claude.mdconventionsfact-checking
by DeliciousGorilla Jul 29, 2026 5/10
skill Reddit

Keeping CLAUDE.md "keeper" rules alive across /doctor trims and model changes

A convention for surviving /doctor's CLAUDE.md trimming: since /doctor keeps no diff of what it cut, snapshot CLAUDE.md before running it. More notably, store the pitfalls/rationale/conventions /doctor preserves as named, versioned files in a prompt library outside any single repo (rather than only inline in one CLAUDE.md), with per-model variants where guidance genuinely differs between model generations — CLAUDE.md then just references what the current repo needs.

claude.mddoctorconventionsversioning
by Dry-Lavishness-2909 Jul 29, 2026 6/10
skill GitHub

neatcontext-plugins: Reusable Domain Knowledge From AI Chats

neatcontext-plugins turns long AI conversations into reusable domain knowledge that carries across sessions, packaged as Claude Code and Codex skills/plugins. It's aimed at cutting down repeated context-setting when working the same domain over multiple sessions.

context-managementskillclaude-code-pluginknowledge-management
by XTSoftwareLabs Jul 29, 2026 6/10
skill GitHub

codex-image-gen: Image Generation Skill via Local Codex CLI

codex-image-gen is an agent skill that generates images by shelling out to a locally installed, OAuth-authenticated Codex CLI, avoiding separate API keys. It enforces exact output sizes and archives every prompt for reproducibility.

skillimage-generationcodexclaude-code
by stephenlzc Jul 29, 2026 5/10
skill GitHub

Living Docs: A No-Drift Documentation System as an Agent Skill

Living Docs is an agent skill that runs project documentation -- constitution, ADRs, BDRs, PRDs, issues, research notes, and Mermaid diagrams -- as a living system under five governance invariants meant to prevent drift from the actual code. It's stack-agnostic and works across Claude Code, Cursor, Copilot, OpenCode, and Pi.

documentationskillgovernanceclaude-code
by ejklock Jul 29, 2026 6/10
skill GitHub

skillshilp: Meta-Skills for Building Production-Quality Agent Skills

skillshilp is a set of meta-skills for creating, reviewing, and maintaining production-quality Agent Skills, spanning Claude, Codex, Copilot, Cursor, and more. It brings consistency and quality control to the growing pile of skill files teams accumulate.

skillmeta-skillqualityclaude-code
by ViGi-P Jul 29, 2026 6/10
skill GitHub

ko-official-doc-style: Korean Official Document Writing Skill

A Claude Code skill that enforces Korean official-document writing standards — article numbering, date and currency formats, punctuation, and spacing conventions — for generated formal documents.

skillkoreandocumentationlocalization
by dltkddns833 Jul 29, 2026 5/10
skill Reddit

gtm-cofounder: 18 Open-Source Go-To-Market Skills for Technical Founders

A set of 18 agent-agnostic GTM skills (plain SKILL.md files) for technical founders who can build but struggle with positioning, first users, and pricing. Interviews the founder, then writes a founder brief and prioritized roadmap into the repo as markdown.

skillgtmstartupmarketing
by ShoddyReference2163 Jul 29, 2026 6/10
skill GitHub

start-working-template: Claude Skill Template for Starting a Work Session

A skill template for launching one focused Claude Code work session — parallel information gathering, a clean-up sweep, a three-question interview, a human/Claude task split, a session card, and close-out logging.

skilltemplatesession-management
by jason8-8 Jul 29, 2026 5/10
skill GitHub

pre-mortem-skill: Pressure-Test a Plan Before Its Next Irreversible Action

Runs a pre-mortem on a concrete plan, surfacing decision-critical failure paths with evidence status, control assessment, and a residual-risk classification (Tiger/Open/Paper). Built for irreversible-action review, not vague intentions or after-the-fact root-cause analysis.

skillriskplanning
by ReedLiner Jul 29, 2026 6/10
skill GitHub

predictdog_skill: Trade on Polymarket via Predictdog

A Claude Code skill for trading on Polymarket through Predictdog — search markets, view your portfolio, check PnL, and place trades from the agent.

skilltradingprediction-markets
by HQSV-Labs Jul 29, 2026 5/10
skill GitHub

azure-lean-stack-skills: Azure Apps That Cost Nothing When Idle

A Claude Code skill pack of 14 composable skills for building Azure apps that scale to zero cost when nobody's using them, documenting 37+ gotchas along with branch-per-environment CI/CD.

skillazurecost-optimizationcicd
by alexpizarro Jul 29, 2026 6/10
skill GitHub

guided-tour: A Live, Interactive Guided Tour of Any Codebase

A Claude Code skill that turns Claude into a hands-on tutor for a codebase — a live, interactive tour with real checkpoints, grounded in file:line citations rather than generic explanations.

skillonboardingdocumentation
by jonascript Jul 29, 2026 6/10
skill GitHub

Divan: Turkish Skill Packages for Claude Code, Cursor, and Codex

A council of vibe-coding skill packages (Turkish) for Claude Code, Cursor, and Codex — an end-to-end orchestrator (Sadrazam), plus planning, TDD, debugging, and UI/UX-React skills.

skillorchestrationturkish
by trugurpala Jul 29, 2026 5/10
skill GitHub

mcp-audit-skill: Systematic MCP Server Audits Against Best Practices

A Claude skill for systematically auditing MCP servers against a curated best-practices corpus — 68 checks across 8 categories covering OAuth 2.1, OWASP, the Lethal Trifecta, and Swiss compliance (DSG/ISDS).

skillmcpsecurity-auditoauth
by malkreide Jul 29, 2026 7/10
skill GitHub

html-explainer-skill: Turn Markdown Answers Into a Single HTML File

An agent skill that swaps a markdown response for a single-file HTML page — tabbed content, dark theme, Bootstrap 5 plus highlight.js via CDN with SRI, a copy button on every block, and tab deep-linking through the URL. Includes a linter that rejects broken ARIA, unescaped code, and floating CDN versions. No npm, no build.

skillhtmldocumentation
by frederico-kluser Jul 29, 2026 6/10
skill GitHub

advisory-panel: A Named Advisory Panel With a Mandatory Dissent Rule

A panel of 3 to 5 named advisory voices for thinking through a decision, with a mandatory-dissent rule so someone always has to disagree with you. Works in Claude chat, Cowork, and Claude Code.

skilldecision-makingadvisory
by MonicaOrtizM Jul 29, 2026 5/10
skill GitHub

Awesome Skills & Plugins for Students (IB, IGCSE, College)

A curated list of Claude Code, Cursor, and Copilot skills and plugins built specifically for students, covering IB, IGCSE, and college-bound coursework. A useful starting point for anyone studying alongside an AI coding agent.

skillsstudentseducationcurated-list
by StudentSuite Jul 29, 2026 5/10
skill GitHub

Deslop: Skills That Strip AI-Sounding Patterns From Writing

Two editing skills for Russian and English text that remove common AI-generated writing tells without flattening the author's voice. Explicitly not a detector-bypass tool, it's aimed at making AI-assisted writing read naturally.

skillwritingediting
by spyrae Jul 29, 2026 5/10
skill GitHub

code-webdesign: Website + Design System Skill With Blocking Checks

A Claude Code skill that builds a website alongside the design system that governs it, enforcing checks that block rather than merely advise. Keeps generated UI consistent with a project's design tokens instead of drifting per page.

skilldesign-systemwebquality-gate
by jaenicket Jul 29, 2026 6/10
skill GitHub

many-ppt-skills: Benchmarked Catalog of 26 AI Slide-Deck Skills

Surveys every AI slide-deck skill worth knowing on one page, covering both HTML and native-PPTX routes, bilingual (English/Chinese). Ranks them with a reproducible benchmark instead of relying on star counts.

skillslidesbenchmarkpresentation
by brycewang-stanford Jul 29, 2026 7/10
skill GitHub

claude-roadmap-skill: Keeps ROADMAP.md Always Current

A Claude Code skill that maintains a ROADMAP.md with live priorities and a revision history, explaining changes as they happen rather than leaving the roadmap to go stale.

skillroadmapdocumentationproject-management
by code-katz Jul 29, 2026 6/10
skill GitHub

svelte-edge: Production-Safe Skill for Svelte 5 and SvelteKit 2

A future-first, production-safe skill for writing modern Svelte 5 and SvelteKit 2 code with AI agents, keeping generated code aligned with current Svelte idioms instead of outdated patterns baked into model training data.

skillsveltesveltekitfrontend
by fifidayone Jul 29, 2026 6/10
skill Reddit

How Much of a Skill Catalog Should an Agent See Before Loading It?

A concrete look at the SKILL.md lazy-loading problem in the open-source OpenHarness agent SDK: every skill's name and description sits in the tool schema on every turn, so a large skill catalog still adds real token overhead even though full skill content only loads on demand. The author is weighing search-based skill discovery over exposing the whole catalog once it grows past a handful of entries.

skillskill-loadingcontextopen-harness
by mgfeller Jul 29, 2026 6/10
skill GitHub

TLDR: Verdict-First Output for AI Coding Agents

A tiny prompt and installer that makes an agent lead with its verdict/conclusion before the reasoning, across Claude Code, Codex, Gemini, Cursor, opencode, and 30+ other agents.

skilloutput-formatconciseness
by 0p9b Jul 29, 2026 6/10
skill GitHub

slow-powers: Eval-Backed Agent Skills

Agent skills for Claude Code, Codex, and OpenCode that are validated with evals rather than shipped on vibes, for developers skeptical of unverified skill claims.

skillevalsverification
by slowdini Jul 29, 2026 6/10
skill GitHub

archivist: Canonical, Auto-Synced Claude Ecosystem Reference

A reference repo that auto-syncs Anthropic's official docs alongside curated team insights, paired with an ask-archivist skill for deterministic local lookup inside Claude Code instead of relying on model memory.

skilldocumentationreferencelookup
by coroboros Jul 29, 2026 7/10
skill GitHub

skillit: Generate SKILL.md From TypeScript API Docs

A TypeDoc plugin, CLI, and Docusaurus/VitePress integration that auto-generates SKILL.md files directly from a TypeScript library's API documentation, keeping agent-facing docs in sync with the actual API surface.

skilltypescripttypedocauto-generation
by pradeepmouli Jul 29, 2026 7/10
skill GitHub

Novera-AI-pipeline: four-agent Specifier→Coder→Refactorer→Architect pipeline

An agent skill that turns a vague requirement into gate-verified code using Gherkin acceptance specs and quality gates on coverage, complexity, duplication, and mutation score, with automatic failure routing between four specialized agent roles. Includes a zero-dependency Python scaffolder, MIT licensed.

multi-agentquality-gatesskillpython
by whaojie797-design Jul 28, 2026 7/10
skill GitHub

claude-smart: turns corrections into reusable preferences and skills

A tool that converts corrections you give an agent into persistent preferences, project-specific skills, and shared skills, working across Claude Code, Codex, and OpenCode. Aims to make an agent learn from feedback instead of repeating the same mistakes.

skillspreferenceslearning
by ReflexioAI Jul 28, 2026 6/10
skill GitHub

vibe-code-efficiency: skill for repo-aware, non-duplicating agent edits

An agent skill for Claude Code, Codex, Cursor, and Gemini/Antigravity that has the agent understand a repo before changing it, so it avoids duplicating schema or dependencies and keeps performance-consistent code. A reasonable pre-edit-discipline pattern, if somewhat generic.

skillcode-qualityrepo-analysis
by tissueeeee Jul 28, 2026 5/10
skill GitHub

lexigram-framework-skills: 14 skills for the Lexigram framework

A set of 14 AI agent skill files covering DI, async SQL, CQRS, caching, resilience, CLI code generation, and testing, targeted at the Lexigram framework but usable with any markdown-aware coding agent including Claude Code.

skillsframeworkbackend
by dbtinoy- Jul 28, 2026 5/10
skill GitHub

Idempotent Markdown Section Merge Skill for Agents

A Claude Code/Codex agent skill that replaces or appends a Markdown section idempotently without corrupting code fences, using fence-aware heading scans and fixed-marker boundaries. Includes a tested reference implementation and an apply-twice-diff-zero verification recipe.

skillmarkdownidempotencydocumentation
by h8nc4y Jul 28, 2026 7/10
skill GitHub

Paper Tutor: 25-Command Academic Research Skill Suite for Chinese Researchers

A Claude Code/Codex skill suite guiding Chinese graduate students and researchers through the full academic pipeline -- topic selection, literature search, writing, review, and submission -- across 25 commands. Citations are verified against real API responses rather than the model's memory.

skillacademic-researchcitation-verificationchinese
by cabbage2000-lab Jul 28, 2026 7/10
skill GitHub

Almagest Survey: Claude Skills for Automated Literature Surveys

A set of Claude skills that automate literature surveys by building verified source corpora, reporting honest metrics, using minimal figures, and producing a short PDF state-of-the-art report.

skillliterature-reviewresearchpdf-report
by DanieleMosh Jul 28, 2026 6/10
skill GitHub

OSS-Kit: Agent Skills for Open Source Maintainers

A curated set of agent skills aimed at open source project maintainers, though the repo description doesn't detail which specific maintainer tasks are covered.

skillopen-sourcemaintainers
by svyatov Jul 28, 2026 5/10
skill GitHub

SQL Server Performance Tuning Skills: 829 Checks Across 26 Skills

A large skill set for LLM-driven SQL Server performance tuning, covering T-SQL, execution plans, wait stats, deadlocks, Query Store, indexes, encryption, Always On AG, WSFC, error logs, memory, disk I/O, config drift, and migration readiness, backed by a remote MCP server on Cloudflare Workers.

skillmcpsql-serverperformance-tuning
by vanterx Jul 28, 2026 7/10
skill GitHub

AgentSkills: Large Community-Driven Library of SKILL.md Agent Skills

A community-maintained collection of Agent Skills (SKILL.md files with scripts, references, and examples) usable across Claude, Codex, Gemini CLI, Cursor, and similar tools, positioned as one of the largest such libraries.

skilllibrarycommunitymulti-tool
by JayRHa Jul 28, 2026 6/10
skill Reddit

Webcmd: turn any website into a CLI skill for Claude Code

Webcmd lets Claude explore a website once, then compiles the learned navigation into a named CLI command so future sessions get structured output instead of re-exploring the page. Installs as a Claude Code skill, supports named login profiles, and falls back through public endpoints, session cookies, and replayed requests before using a browser.

skillcliweb-scrapingautomation
by Opening-Profile6279 Jul 28, 2026 7/10
skill GitHub

hwpx: Claude Code skill for generating and editing Korean HWPX documents

An agent skill that reads, writes, and edits HWPX (.hwpx) files — the Hancom Office Hangul word processor format — and auto-converts Markdown, text, or URLs into HWPX documents. Fills a specific localization gap for Korean-language document workflows.

skillkoreandocument-generationhwpx
by imsebeom Jul 28, 2026 6/10
skill GitHub

Brand Agency Skill: full brand strategy engagements for AI agents

An Agent Skill for running large-scale brand strategy and identity work, structured as 10 evidence-backed research workstreams with iterative cross-team debate, producing 7 implementation-ready deliverables. Works across Claude Code, Codex, Cursor, and Copilot.

skillbrandingstrategyresearch
by simone-sestili Jul 28, 2026 6/10
skill GitHub

Prompt Engineering Skill: research-grounded prompt writing for LLMs

An Agent Skill that helps write prompts by matching techniques to the target model class and separating evidence-backed practices from folklore. Aimed at making prompt engineering more systematic rather than trial-and-error.

skillprompt-engineeringllm
by k-vaca Jul 28, 2026 5/10
skill GitHub

ux-motion-skills: production UX motion judgment skills for Claude Code

A set of Claude Code skills (motion-judgment, motion-guide, handoff, design-critique, ai-slop-detector, concept-gate) distilled from 11 years of production UX motion design work. Aims to give agents professional design judgment rather than generic 'make it nice' output.

skilldesignuxmotion
by kjooncho Jul 28, 2026 7/10
skill GitHub

flow-lean: a minimal, action-first output mode for Claude Code

A Claude Code output style that fuses caveman, ponytail, and 'i-have-adhd' modes into one rule set: minimal solution, action-first structure, zero-fat density. For users who want terser, less verbose agent responses.

output-styleverbositycommand
by FlorianBruniaux Jul 28, 2026 5/10
skill Reddit

Hierarchical Agent System: a Claude Code skill that designs its own agent teams

Given an objective, a central 'Designator' agent decides how many hierarchy levels a task needs, which specialist sub-agents to create, and which model tier each runs on, so cheap or local models handle most work and expensive models only make decisions that need to crystallize. A single mapping.json is the source of truth, read cheaply before each task so the design agent doesn't wake up unnecessarily.

skillmulti-agentcost-optimizationorchestration
by Aggravating_Bid1129 Jul 28, 2026 7/10
skill GitHub

seo-aeo-audit: evidence-first SEO and answer-engine audit skill

An audit skill covering ten tracks for both traditional search and AI answer engines, with every finding backed by an observation and every recommendation tiered into a prioritized change plan. Includes a dated Google update timeline, 59 growth plays, and 29 refuted SEO myths.

skillseoauditmarketing
by ssheleg Jul 28, 2026 6/10
skill GitHub

Interlinear: agent skill for reading technical papers with Chinese annotations

A Claude Code skill for reading technical papers that adds inline Chinese annotations, reader-adaptive explanations, and geometric intuition to help readers work through dense material. Niche but concrete use case for research reading workflows.

skillresearchtranslationpapers
by BladeDancer743 Jul 28, 2026 6/10
skill GitHub

manimgl-skill: Claude Code skill for 3Blue1Brown's original ManimGL

An agent skill specifically for ManimGL, the original 3Blue1Brown animation engine, as distinct from the more commonly supported Manim Community Edition. Fills a specific compatibility gap for people using the original library.

skillmanimanimationmath
by do-gongil Jul 28, 2026 6/10
skill GitHub

feynman-technique: an Agent Skill that explains like Richard Feynman

A Claude Code skill structuring explanations as mechanism-before-name with one honest analogy stating its limits, plus a difficulty ladder from kitchen-table to specialist level. Built from an ~88k-word corpus of primary-source material on Feynman's teaching style.

skillteachingexplanation
by guicortei Jul 28, 2026 7/10
skill GitHub

md-paper: Word-Markdown-Word revision workflow for academic manuscripts

A Claude Code skill workflow converting Word manuscripts to Markdown and back while preserving live Zotero citations and cross-references. Useful for academics editing papers with AI assistance without breaking their citation manager.

academic-writingzoteromarkdown
by pwya Jul 28, 2026 7/10
skill GitHub

sheleg-design-skill: cinematic scroll-driven landing page design skill

A stack-agnostic Claude Code skill teaching agents a cinematic, scroll-driven design methodology for landing pages and hero sections, plus style packs for product UI. Positioned as a 'taste layer' of design judgment rather than a component library.

skilllanding-pagesdesign
by ssheleg Jul 28, 2026 7/10
skill GitHub

liustack: a lighter Superpowers alternative — four skills, one loop

A compact Claude Code skill set positioned as a lighter alternative to Superpowers, built around four skills covering a full working loop: shape it, code it, dig it, snapshot it. Aimed at people wanting a simpler skill stack than larger frameworks.

skillworkflow
by liustack Jul 28, 2026 6/10
skill GitHub

vishwakarma: 21 Claude Code skills for design judgment and accessibility

A set of 21 skills covering design judgment, colour, motion, accessibility, layout, and theming for coding agents, compatible with Claude Code, Cursor, Windsurf, Cline, and more. Aimed at giving agents structured design taste rather than just component templates.

skilldesignaccessibility
by yogvidwankhede Jul 28, 2026 6/10
skill GitHub

claude-code-deep-review: 14-lens iterative code review methodology

A structured deep-review methodology for Claude Code that runs code through 14 distinct review lenses iteratively; the author reports it found 14 production bugs, including 2 ship-stoppers, on its first real use. Useful as a reusable review skill for catching issues a single-pass review misses.

code-reviewskillquality
by aksheyw Jul 28, 2026 8/10
skill GitHub

Axle Keys Skills: Design Manufacturable Hardware with Claude

Free, open Claude skills that teach an AI agent to design real, manufacturable things using Axle Keys' engineering conventions. Aimed at hardware/mechanical design workflows rather than pure software.

skillhardwaremanufacturingdesign
by AxleKeys Jul 28, 2026 5/10
skill GitHub

MailChannels Official Claude Code Plugin for Email Deliverability

Official MailChannels skills for Claude Code and Codex, giving agents direct access to MailChannels' email API/tools. Useful for teams already on MailChannels who want agent-driven email deliverability workflows.

pluginemailmailchannels
by mailchannels Jul 28, 2026 5/10
skill GitHub

dibble: Guardrails and Craft Checks for Coding Agents

A set of portable skills, Claude Code plugins, and zero-dependency CLI checks covering design tokens, supply-chain safety, evidence-backed writing, and UI verification for agent-tooling workflows. Aimed at teams wanting lightweight, dependency-free guardrails around agent output quality.

skillguardrailssupply-chainui-verification
by connordibble Jul 28, 2026 6/10
skill GitHub

HackerNews-Brief: Personalized Hacker News Digests Inside Claude Code

A zero-dependency tool that generates personalized Hacker News briefs inside Claude Code, learning your interests from what you click over time. A lightweight way to get a curated tech news feed without leaving your terminal.

skillnewspersonalization
by ArchitektApx Jul 28, 2026 6/10
skill GitHub

socialforge: Agency-Grade Social Media Production Plugin with AI Image/Video and C2PA Signing

An open-source social media production plugin with 16 skills and 25 commands covering AI image (Nano Banana Pro) and video (Kling v3.0 Pro) generation, plus C2PA content-provenance signing for EU AI Act Article 50 compliance. Installs across Claude Code, Codex, Cursor, Copilot CLI, and more.

skillsocial-mediacontent-generationcompliance
by indranilbanerjee Jul 28, 2026 6/10
skill GitHub

Praxis: 16-Skill Methodology Library for Disciplined AI-Driven Development

A Claude Code skill methodology library establishing rules for AI-driven development: seven-layer documentation governance, adversarial review, and a task-control triad, plus skills for legacy-code archaeology and construction blueprints. Aimed at keeping AI-written code fast without losing control.

skillgovernancecode-reviewdocumentation
by BackToCimaCoppi Jul 28, 2026 6/10
skill GitHub

god-of-the-void: A Claude Code Skill with Persistent Memory, Semantic Search, and a Local Dashboard

A heavily built-out Claude Code skill offering persistent cross-session memory, near-zero-token semantic search, an 'errarium' that flags repeated mistakes before you make them again, caged autonomy controls, and a local dashboard — organized into 16 'organs' and 54 commands, with 1,650 tests and zero dependencies.

skillmemorysemantic-searchdashboard
by CHAOSX-SPACE Jul 28, 2026 6/10
skill Reddit

itr-wala: Claude Code Skill That Prepares Indian Tax Returns with Deterministic Python Math

A free, MIT-licensed Claude Code skill for filing Indian income tax returns (AY 2026-27): Claude reads your Form 16/AIS/broker statements and interviews you for deductions, but every calculation — both tax regimes, capital gains, surcharge marginal relief, interest, and loss set-off — runs in tested, deterministic stdlib Python rather than the model. Backed by 47 golden tests and a 350,000-run property fuzzer that caught real rounding and marginal-relief bugs before release, and it explicitly refuses cases outside its scope (NRI, F&O, audits) and never touches your portal password or submit button.

skilltaxindiadeterministic-computation
by karanb192 Jul 28, 2026 8/10
skill Reddit

Auto Memory System: A Scheduled Task That Teaches Claude Code to Remember Things on Its Own

A Windows scheduled task that runs Claude Code every morning to scan the prior day's session files and write anything worth keeping into a persistent memory directory, with no manual 'remember this' prompts required. Guardrails prevent emotional content, fabrications, and deletions; five days of real use produced six new memories with zero duplicates.

skillmemoryautomationscheduled-task
by ZingLam0924 Jul 28, 2026 6/10
skill GitHub

vibe-ship: Turn Any Codebase into a Hardened, Deployable App in One Pass

A Claude Code / Claude.ai skill that makes any codebase deployable via `docker compose up` and shippable through CI/CD, generating hardened defaults in a single pass. Aimed at closing the gap between 'it runs locally' and 'it's actually deployable.'

skilldeploymentdockerci-cd
by sudais-khalid Jul 28, 2026 6/10
skill GitHub

van-rental-search: Claude Code Skill for Vancouver Rental Search

A Claude Code skill that searches vanpeople and vansky rental platforms for Vancouver listings, filtering by city, bedrooms, price, and facilities. It deduplicates results, classifies units as above-ground, and exports contact lists as Markdown or HTML. A concrete example of building a domain-specific search skill with structured output.

skillsearchreal-estatevancouvermarkdownhtml
by gaoxiaowei2117 Jul 27, 2026 5/10
skill GitHub

skill-adherencia-reglas: Measure Claude Code Agent Rule Compliance

An installable Claude Code skill that reads session history from disk and computes a compliance percentage per configured rule — no network, no dependencies beyond the standard library. Helps you quantify how reliably your Claude Code agent follows the rules defined in CLAUDE.md or other instruction files. Useful for debugging agent drift in long sessions.

skillcompliancerulesCLAUDE.mdsession-analysisaudit
by jleonceo Jul 27, 2026 8/10
skill GitHub

awwwards-skill: Claude Code Skill Encoding the Awwwards Design Rubric

A Claude Code skill that encodes the Awwwards judging rubric (Design 40 / Usability 30 / Creativity 20 / Content 10) as an 8-phase build method with 16 curated references, working templates, and a runnable real-browser audit step. Designed to systematically raise the quality bar of AI-generated web UIs against a professional design scoring system.

designuiwebskillauditawwwards
by SandroHub013 Jul 27, 2026 7/10
skill GitHub

PRD-First Multi-Model Agent Skills for Claude, Gemini, and Codex

A portable set of agent skills that start from a Product Requirements Document and propagate architecture and design-system context throughout the development process. Works across Claude, Gemini, and OpenAI Codex with verified multi-model development support.

skillsprdmulti-modelarchitecturedesign-system
by Cartograf666 Jul 27, 2026 6/10
skill GitHub

46 Tested DevOps, Security, and Engineering Skills for Claude Code

A large, maintained collection of 46 Claude Code skills covering DevOps, security, infrastructure, and software engineering. Skills are quality-controlled through lint/spec checks, behavioral test coverage, and a Karpathy-style autoresearch loop — one of the most systematically tested skill packs available.

skillsdevopssecurityinfrastructuretesting
by iuliandita Jul 27, 2026 7/10
skill GitHub

29 Drop-In Claude Code Skills: Model Routing, Debugging, and Laws of Software

A curated set of 29 skills covering cost-tier model routing, debugging patterns (rubber-duck, test-first bugfix, trust-but-verify), and 24 software-law reference skills. Installs with a single npx command. Practical and opinionated about when to use each model tier.

skillsmodel-routingdebuggingsoftware-lawsnpx
by The-Artificer-of-Ciphers-LLC Jul 27, 2026 7/10
skill GitHub

Bangers: Nine Skills for Cross-Platform Social Media Content Creation

A social media content studio built on the playbooks of popular creator-educators like Matt Pocock, Theo, and ThePrimeagen. Nine skills turn a single idea into platform-specific content across multiple channels. Opinionated about voice and format.

skillssocial-mediacontenttwittercreators
by Jeff-Kazzee Jul 27, 2026 6/10
skill GitHub

bs-check: Two-Lane Confidence Audit Skill for Claude Code

A skill that runs two parallel verification lanes: a reasoning audit (checking premise, approach, and fresh thinking) and a claim-verification pipeline that passes or blocks each assertion through context-isolated judges. Designed to catch overconfident or unsupported claims before they reach your codebase.

skillsverificationconfidenceauditclaims
by GemSpecter Jul 27, 2026 7/10
skill GitHub

Multi-Agent System Architect: Design, Build, Audit, and Port Agent Systems

An agent skill that first questions whether an agentic system is needed at all, then walks through design, construction, auditing, verification, and porting across frameworks. Covers the full lifecycle from simple workflows to governed agent teams, with sanity checks at each stage.

skillsmulti-agentarchitectureauditagent-design
by ingcontartese-netizen Jul 27, 2026 7/10
skill GitHub

Autonomy: Issue-to-Clean-PR Skill with Self-Review and CI Monitoring Loop

A Claude Code skill that takes a GitHub issue and drives it all the way to a clean pull request: plan, validate, implement, self-review, ship, then monitor CI and review feedback and iterate until the PR passes. Designed to operate unattended while maintaining a high quality bar.

skillsgithubprciautonomousissue-driven
by jakozloski Jul 27, 2026 8/10
skill GitHub

Resume Skills: Offline Context Migration Across 9 Agent Sources and 9 Hosts

Skills for migrating session context between 9 different coding-agent sources (Claude Code, Codex, Cursor, etc.) and 9 target host environments — 81 source/dest combinations in total. Uses only stdlib, no dependencies. Generates a static context handoff artifact for the next session rather than a live restore.

skillscontextmigrationsessionmulti-agent
by ImL1s Jul 27, 2026 6/10
skill GitHub

7 UX and Product Design Skills for Claude Code

A set of 7 skills covering UX research, product design, and user experience work in Claude Code sessions. Provides structured approaches to design tasks that would otherwise require custom prompting each time.

skillsuxproduct-designuiresearch
by JoaoMonteiro100 Jul 27, 2026 6/10
skill GitHub

Open Skills: Readable Agent Skills with Declarative YON Protocol Validation

A personal, field-tested skill pack prioritizing human readability. Skills optionally include declarative YON (yes/or/no) protocol specifications that can be inspected and validated independently. Prioritizes transparency and auditability over magic.

skillsreadablevalidationprotocolopen-source
by allemaar Jul 27, 2026 6/10
skill GitHub

Twitr Skills: Pay-Per-Call X/Twitter API for AI Agents via USDC Wallet

Agent skills for twitr.sh, a pay-per-call X/Twitter API service for AI agents. No developer API key required — a USDC wallet pays per call. Enables Claude Code agents to query Twitter data on a usage basis without a developer account.

skillstwitterxapicryptousdc
by lnvestor Jul 27, 2026 5/10
skill GitHub

Headless GTM: Full Outbound Sales Chain as Claude Code and Codex Skills

A set of skills implementing the complete go-to-market outbound pipeline — discover, qualify, extract, signal, judge, resolve — directly on raw vendor APIs with no SaaS layer. Designed for teams that want full control over their prospecting stack without paying for middleware.

skillsgtmsalesoutboundcrmb2b
by Zevenue Jul 27, 2026 5/10
skill GitHub

Research Agent Pitfalls: Standing Rules to Keep AI Research Agents Honest

A Claude Code skill that installs standing rules guarding against common AI research agent failure modes: reward hacking, fabricating results after failed runs, data leakage, undertuned baselines, single-seed claims, LLM-judge bias, and premature completion. Applies to Claude Code, Codex, and Cursor.

skillsresearchintegritysafetyanti-hallucinationscience
by jackiectl Jul 27, 2026 7/10
skill GitHub

open-claude-all: Claude Code Skills and Hooks for Clean PRs and Impact Pre-Verification

Claude Code skills and hooks focused on shipping clean PRs and pre-verifying the impact of changes on existing code. Covers PR quality gates, Kotlin/JVM Spring, React/Next.js, and NestJS stacks. Useful for multi-stack teams who want consistent PR quality across different tech stacks.

skillshooksPRscode-reviewmulti-stack
by BK202503 Jul 27, 2026 7/10
skill GitHub

DeepPaperNote: Agent Skill for Deep-Reading Papers and Generating Obsidian Research Notes

An agent skill that deep-reads a single research paper and generates high-quality Obsidian-style research notes from it. Works with Claude Code, Codex, Cursor, Copilot, and Gemini CLI. Useful for researchers and academics who want structured, reusable notes from paper reading sessions.

researchObsidiannotesacademicskill
by 917Dhj Jul 27, 2026 6/10
skill GitHub

stylewright: Anti-Slop Writing Skills for Claude Code and Codex

Writing skills for Claude Code, Claude Cowork, and Codex grounded in real style standards rather than generic LLM defaults. Designed to produce technical writing that reads as deliberate and human rather than AI-generated. Install as any standard agent skill.

writingstyleskillsqualityanti-slop
by rookslog Jul 27, 2026 6/10
skill GitHub

Generative-Media-Skills: Multi-Modal Image, Video, and Audio Generation for Claude Code

A multi-modal generative media skill pack for Claude Code, Cursor, and Gemini CLI that enables high-quality image, video, and audio generation from within coding agent sessions. Useful for building media-rich applications or generating assets during development.

image-generationvideoaudiomulti-modalskills
by SamurAIGPT Jul 27, 2026 6/10
skill GitHub

lit-review-agent-tools: 70+ Open-Source Tools for AI-Assisted Literature Review

A curated catalog of 70+ open-source AI agent tools for academic literature review, organized across 11 categories including Claude Code skills, deep research, MCP servers, PDF parsing, and systematic review. A comprehensive starting point for researchers using AI coding tools for literature work.

academicliterature-reviewMCPresearchskills
by brycewang-stanford Jul 27, 2026 6/10
skill GitHub

book-writing-skill: Claude Code Skill That Turns a Drafts Folder Into a Produced Book

A Claude Code skill that takes a folder of draft content and produces a complete book: structural blueprint, hand-paginated chapters, and a verified PDF. Automates the book production pipeline from rough drafts to finished output without a dedicated publishing workflow tool.

writingbookPDFpublishingskill
by swiftugandan Jul 27, 2026 6/10
skill GitHub

marketing-skills: 100 Open-Source Claude Code Skills for SEO, Content, and GEO

A collection of 100 markdown skill files across 9 categories covering SEO, content creation, and Generative Engine Optimization (GEO) for Claude Code, Cursor, and compatible tools. GEO focuses on optimizing content for AI-generated search responses rather than traditional search engines.

marketingSEOGEOcontentskills
by dahiyaakshay Jul 27, 2026 6/10
skill GitHub

engineering-diagram-toolkit: AI-Powered Architecture Diagrams for Claude Code and Codex

A skill that generates evidence-grounded software architecture diagrams from actual codebases using Claude Code and Codex. Covers features, data flows, patterns, system design, and engineering decisions. Diagrams are grounded in real code rather than hallucinated from documentation.

architecturediagramsdocumentationskillCodex
by amirtaherkhani Jul 27, 2026 6/10
skill GitHub

docforge: Claude Code Skill to Generate Documentation From Source Code

A simple Claude Code skill that reads your source code and generates structured documentation from it. Install as a plugin and invoke to produce documentation for your codebase. Straightforward automation for the documentation task most developers put off.

documentationskillautomationcode-docs
by jonaskahn Jul 27, 2026 6/10
skill GitHub

design-lagann: Design Agent Skill for Claude Code, Codex, and Cursor

A design agent skill that plans first, finds visual references, builds intentional interfaces with considered motion design, and proves the result. Targets the gap in AI coding tools where generated UIs work functionally but lack deliberate design decisions.

designUIskillmotioninterfaces
by Oldiiik Jul 27, 2026 6/10
skill GitHub

claude-code-optimizer: Skills, Rules, Hooks, and Templates to Cut Token Use

A curated collection of skills, rules, hooks, and templates specifically designed to reduce token consumption and accelerate shipping with Claude Code. Bundles optimization techniques from the community into an installable package targeting developers who want faster and cheaper Claude Code sessions.

tokensoptimizationskillshookstemplates
by pupillary-rosewater603 Jul 27, 2026 7/10
skill GitHub

sitesmith: Coding Agent Skill for Building Non-Generic-Looking Websites

A skill that routes website-building tasks through a mode-specific workflow, enforces a 12-step build loop, and actually renders and measures the result instead of stopping at the code. Designed to prevent the generic AI-generated website look by embedding quality gates into the build process.

webdesignskillsworkflowquality
by byensitmagnus Jul 27, 2026 7/10
skill GitHub

claude-saas-readiness: Agent Skill for Auditing SaaS Production Readiness

A Claude Code skill that audits any SaaS application for production readiness across security, scalability, reliability, testing, observability, and compliance. Reports findings first and only proposes fixes after you approve, with no scripts that execute automatically. Works with any tech stack.

SaaSauditsecurityreliabilityskill
by smiladinov Jul 27, 2026 7/10
skill GitHub

claude-academic-workflow: 14 Claude Code Skills for Academic Research Workflows

A suite of 14 Claude Code skills covering academic research tasks: paper reading, literature review, bibliography auditing, preregistration, referee reports, replication packages, LaTeX, and TikZ generation. Also includes a Quarto reveal.js slide system with render-time quality gates. Built as a proof-of-concept with Claude Code itself.

academicresearchLaTeXliterature-reviewskills
by ericluo04 Jul 27, 2026 7/10
skill GitHub

agent-skills: Dev Cycle Skills Covering Ticket Intake, ATDD, Code Review, and PRs

A skill pack that wraps the full development cycle for Claude Code: ticket intake, acceptance-test-driven development planning, code review, doc-drift audits, PR writing, and changelog generation. Designed to bring structure to agentic development from spec to shipped PR.

skillsATDDcode-reviewPRsdev-cycle
by Flagrare Jul 27, 2026 7/10
skill GitHub

ui-craft: Design Engineering System for AI Coding Agents to Ship Craft-Level UI

An agent skill that brings design engineering principles to AI coding agents for building high-quality UI. Enforces visual hierarchy, interaction design, and accessibility standards through the skill workflow. Targets the gap between functional and polished UI in AI-generated code.

UIdesigncraftskillfrontend
by educlopez Jul 27, 2026 7/10
skill GitHub

claude-ship-skills: Shipping Skills for Claude Code with PR Fan-out and Pre-ship Critic

A Claude Code skill pack covering single PRs, parallel PR fan-out, multi-phase epics, and a ruthless pre-ship critic. One session chairs the entire release so context never splits across agents. Ideal for teams shipping iterative features with AI-powered review gates.

shippingPRsfan-outskillsworkflow
by davidtheproduct Jul 27, 2026 8/10
skill GitHub

swarm-skill: Autonomous Multi-Agent Orchestrator for Claude Code

Fans out sub-agents to explore, diagnose, fix, review, and verify a codebase in parallel. Uses a cross-checked, ledger-backed approach and keeps iterating until the code is production-ready. A skill-based drop-in for Claude Code projects needing thorough automated remediation.

multi-agentorchestrationskillautomationcode-review
by SaarthurR Jul 27, 2026 8/10
skill GitHub

Claude Code Skill for Hardening Formally Verified Code Over FFI

Provides a Claude Code skill and worked Rocq→Rust→Python example for hardening formally verified code extracted to native libraries: proved input domains, checked-arithmetic builds, panic containment, and differential tests. Targets teams using formal methods who need to verify safety across the FFI boundary.

formal-verificationffirustsafetyskill
by cosmindxu Jul 27, 2026 6/10
skill GitHub

engineer-writing: Claude Code Skills for Engineers Who Write

Opinionated skills that force you to give Claude your actual voice and the real work behind a piece of writing, rather than a generic prompt. Intended for engineers publishing blog posts, documentation, or technical essays who want output that sounds like them.

writingskilldocumentationvoicecontent
by foxontheerun Jul 27, 2026 6/10
skill GitHub

Skills-Atlas: Searchable Catalog and Auto-Curator of AI Agent Skills

Indexes and auto-curates skills for Claude Code and Codex so you can search rather than browse scattered repos. Helps teams discover relevant community skills before writing new ones from scratch.

skillcatalogdiscoverycodexcommunity
by Zita-Go Jul 27, 2026 6/10
skill GitHub

dewey-decimal-skill: Rename and Reorganize EPUB Libraries by Dewey Decimal

Claude Code skill that classifies and renames EPUB ebooks using Dewey Decimal numbers, reorganizing a messy library into a consistent structure. A practical single-purpose skill for researchers or heavy readers with large ebook collections.

skillepublibraryorganizationbooks
by brege Jul 27, 2026 5/10
skill GitHub

ai-central: Central Library of Steering Files, Skills, and Scaffold Scripts

Provides a curated, reusable set of AGENTS steering files, Claude Code skills, and project scaffold scripts so teams can configure AI coding context consistently across projects. Includes guided setup for both new and existing codebases.

skillagentsscaffoldconfigurationcontext
by dills122 Jul 27, 2026 7/10
skill GitHub

loadout: Manage Claude and Codex Skills From a Git Repo You Own

Lets you store and version your Claude Code and Codex skills in a personal git repo, then load them into any project. Keeps skills portable, reproducible, and under your own version control rather than scattered across machines.

skillgitversion-controlcodexmanagement
by sethdeckard Jul 27, 2026 7/10
skill GitHub

compass-core: Reusable Governance Engine for Claude Code — SOPs, Validators, Subagent

compass-core is a drop-in governance layer for Claude Code projects with standard operating procedures, input validators, and a governance skill backed by a dedicated subagent. Designed to be shared across projects so teams enforce consistent behavioral guardrails.

skillgovernancesopsvalidationsubagent
by the-metafactory Jul 26, 2026 7/10
skill GitHub

laravel-ai-sdk-toolbox: Claude-Compatible Skills and CLI Tools for Laravel AI Agents

Extends the Laravel AI SDK with Claude Code-style skills, CLI tools, and knowledge bases for agent-powered Laravel apps. Adds a security-first trust model and an opt-in HTTP management layer. Useful for teams building Claude-powered backends in the PHP/Laravel ecosystem.

skilllaravelphpagentsecurity
by andreagroferreira Jul 26, 2026 6/10
skill GitHub

vibe-rules: Context-Aware AI Coding Standards That Load Only When Relevant Files Are Open

vibe-rules delivers coding standards to AI agents only when a matching file is open, keeping the context window small. Hooks block unsafe patterns that tests cannot catch. Ships 20 modules covering PHP, JS, Python, SQL, and ops — built to reduce the risk in AI-generated code.

skillstandardsruleshookscontext
by DanielLetto2020 Jul 26, 2026 8/10
skill Reddit

Community Advice: What Actually Works in CLAUDE.md Instead of "Make No Mistakes"

Reddit discussion asking what practitioners actually put in their skills and CLAUDE.md to prevent bugs and poor decisions. Responses surface real-world configurations, mental models, and specific instructions that have worked. Useful for anyone looking to improve their system prompt or skill configuration beyond generic platitudes.

claude.mdskillprompt-engineeringcommunity
by bluespiritgg Jul 26, 2026 6/10
skill Reddit

Skills vs MCP Servers vs Plugins: The One Test That Clarifies Every Case

Detailed Reddit guide that explains the practical distinction between Claude Code skills, MCP servers, and plugins with one decisive test: if Claude already has access but does the job wrong, use a skill; if it genuinely cannot reach the system, use MCP; if you want distribution, use a plugin. Includes a real example of a wasted weekend building an MCP that should have been a SKILL.md, plus the real context-cost of over-connecting servers.

skillmcppluginarchitecturebest-practicesdecision-framework
by Bulky_Ad738 Jul 26, 2026 8/10
skill GitHub

Uscha: 9 Agent Skills and Evidence Engine for Spec-Driven LLM Development

Provides 9 agent skills and a stdlib evidence engine that distinguishes facts from guesses. Known facts block progress until resolved; guesses surface as advisory notes; humans approve before proceeding. Adds a structured, evidence-backed workflow layer to LLM coding agents targeting overconfident output.

spec-drivenevidenceskillverificationguardrails
by andresmassello Jul 26, 2026 7/10
skill GitHub

Agent Handoff Docs: Multi-Session Documentation Framework for Claude Code and Codex

Documentation framework with split REQUIREMENTS, ARCHITECTURE, REPORT, and HANDOFF files plus START_HERE kickoff files for multi-session, multi-agent development. Task ledgers double as delegation specs so an incoming agent knows exactly what to pick up. Includes bilingual (EN/JA) templates.

handoffmulti-sessiondocumentationmulti-agentskillbilingual
by h8nc4y Jul 26, 2026 7/10
skill GitHub

Wireframe Skills: Complete Wireframing Discipline as 7 Agent Skills

Distills the wireframing methodology from Wireframing for Everyone (A Book Apart) into 7 agent reference skills plus a /wireframe dispatcher for Claude Code. Covers the full workflow from concept to handoff as Claude Code slash commands. Useful for product teams using Claude Code for design documentation and UX planning.

wireframingdesignskilluxdocumentationproduct
by jpoindexter Jul 26, 2026 6/10
skill GitHub

Agent Skill Bootstrap: Auto-Detects Project Stack and Installs Only Relevant Skills

Detects the project tech stack and installs only the agent skills that Claude Code, Codex, and Grok actually need for that specific stack. Avoids bloating context with irrelevant skills and provides a clean, targeted skill set from project start. Good for onboarding Claude Code into existing projects.

skillbootstrapproject-setupstack-detectioninstallationonboarding
by lucascharao Jul 26, 2026 7/10
skill GitHub

Agent-DB: Intraagent Instruction, Skill, and Config Manager for Claude and Codex

Manages agent instructions, skills, and configurations across Claude and Codex sessions from a single interface. Provides structured storage and retrieval of agent-specific knowledge within a session. Useful for teams maintaining consistent skill sets and configurations across multiple AI coding agents.

skillconfigagentmanagercodexmulti-agent
by brege Jul 26, 2026 7/10
skill Reddit

claude-nextsession: Schedule Claude tasks to run after session limit resets

A Claude Code skill that defers tasks and automatically launches them when the 5-hour usage window resets. Supports scoped permissions, generates catch-up reports, and handles the common problem of being interrupted mid-task by session limits.

skillsessionschedulinglimits
by pcx_wave Jul 26, 2026 7/10
skill Reddit

Humanizer: Agent skill that removes AI prose patterns at the structural level

A Claude Code skill that edits AI-generated prose by targeting structural patterns — repeated list formats, punctuation pivots, vague attribution, and predictable conclusions — not just swapping out buzzwords. Includes separate German and English editing rules and preserves numbers and uncertainty. MIT-licensed.

skillwritingprosehumanizerediting
by Quick_Cartoonist_441 Jul 26, 2026 7/10
skill Reddit

GrugDone: Agent skill for keeping Claude reasoning traces compact

A small open-source Agent Skill for Claude Code that prompts the model to keep exposed reasoning traces compact — targeting reasoning narration, obvious decision announcements, and prompt repetition. A preliminary run showed 32% fewer reasoning words, though broader quality impact is still being evaluated by the community.

skillreasoningtoken-efficiencycompact
by FlatCarrot3943 Jul 26, 2026 6/10
skill Reddit

Claude Code optimization: CLAUDE.md, permissions, and stateless sessions explained

A practitioner shares key mental models for optimizing Claude Code — understanding the model/hands split, stateless sessions requiring fresh context each turn, and CLAUDE.md as the highest-leverage configuration file. Covers using allow/deny permission lists to reduce babysitting and why session hygiene matters.

CLAUDE.mdpermissionssessionsconfiguration
by Talley-Ho Jul 26, 2026 7/10
skill Reddit

/einstein: Force Claude to prove code understanding before acting

A Claude Code skill that requires the agent to explain code in numbered steps (one structural fact per step, dependency order, no jargon, source anchor for every claim) before planning or implementing anything. Prevents vague "trust me" explanations and catches fake understanding hidden behind jargon.

skillunderstandingverificationcode-review
by NotEvenSweaty Jul 26, 2026 8/10
skill GitHub

Arabic skills atlas for Claude Code

An Arabic-language skills atlas providing Claude Code skills and documentation for Arabic-speaking developers.

arabicskillsatlaslocalization
by unknown Jul 26, 2026 5/10
skill Reddit

Skills that make Opus 5 more reliable

After my previous post about my first impressions with Opus 5 I tried to improve it's reliability. These skills and Claude.md changes seem to be working for me and I hope they might prove useful fo...

skillclaude.md
by ShaneeNishry Jul 25, 2026 8/10
skill Reddit

How can I get Claude to stop spamming?

Hey, long time listener first time caller. I'm running into a problem that I know we've all faced but it's getting much worse, Claude instances are using chat as a scratch pad for every random thin...

skillworkflow
by SnooblesIRL Jul 25, 2026 6/10
skill GitHub

true-skills:

true-skills:

skill
by katalon-labs Jul 24, 2026 5/10
skill Reddit

When are we banning the “[model] feels nerfed” posts

I see one of these posts on my feed literally every day. 1) they’re probably bots 2) if they’re not bots then it’s a skill issue submitted by /u/LivingFrosting6680 [link] [comments]

skill
by LivingFrosting6680 Jul 24, 2026 5/10
skill Reddit

Prompt engineering was the beginning.

AI engineering is moving toward loops, graphs, harnesses, skills, memory, and agent fleets. I wrote a practical breakdown of how these layers combine—and when each one earns its complexity. https:/...

skill
by ivasuy Jul 24, 2026 6/10
skill Reddit

Self improvement loops

Hey guys wanted to check if self improvement loops for your setup skills, agents, project instructions actually work? I have a feeling this is a risk for garbage piling up - the How does one do it ...

skill
by Safe-Analysis-5804 Jul 24, 2026 7/10
skill GitHub

neo-skills: Neo Skills 是專為現代 AI Agent 設計的全方位能力擴充套件。本專案透過標準化的通訊架構,為 AI 代理安裝可插拔的「技

Neo Skills 是專為現代 AI Agent 設計的全方位能力擴充套件。本專案透過標準化的通訊架構,為 AI 代理安裝可插拔的「技能模組 (Skills)」,使其不僅僅是一個聊天機器人,而是能轉化為具備「感知-推理-行動」能力的多領域專家。

skill
by Benknightdark Jul 24, 2026 6/10
skill Reddit

New to Claude from Codex, have a question

Why can’t I use auto mode on haiku? Back when I was on codex I would use 5.5 for most coding work but any smaller skill based workflows like small sql requests or writing Jira cards I would use 5.4...

skillworkflowtestingreview
by YaBoiLeeDawg Jul 24, 2026 8/10
skill GitHub

skill-compress:

skill-compress:

skill
by xiaowu89 Jul 24, 2026 5/10
skill GitHub

skill-function:

skill-function:

skill
by xiaowu89 Jul 24, 2026 5/10
skill Reddit

I built a Skill Market for claude skills

Skills are all over the place so I built a repository where you can host skills, curate skills, share. It even comes with a cli for your agent to use. Hopefully it will self rank so best ones raise...

skilltesting
by Negative_Leave5161 Jul 24, 2026 7/10
skill Reddit

Do you suggest any good skill for game design /unity?

Hi, What's the best skill for Claude code with Unity? I've checked a few skills on skills.sh and they're basically wrappers for "use best practices, you're a skilled programmer". I'm looking for ma...

skill
by game-dev2 Jul 24, 2026 8/10
skill Reddit

Improving skills and plugins

I've build a series of different skills, and after the first iteration I'm trying to think of ways I can improve. One obvious way is to improve how long the skill file is because I don't want it ho...

skillapi
by StrikingSkill573 Jul 23, 2026 5/10
skill Reddit

Endless review cycles

I implement a feature and review (skill or plugin) a several times my code. It finds a lot of issues again and again and it just gets more code. I finally push to gitlab merge request and the revie...

skillgitreview
by Strawberry7352 Jul 23, 2026 5/10
skill Reddit

Beginner here on Claude Code

Hey. I'm new to Claude Code, coming from Antigravity and Gemini models. Is there any advice, tips, or skills I should know about to ensure good rate limits, and overall experience? I'm a beginner, ...

skill
by Primatronus Jul 23, 2026 8/10
skill Reddit

Thoughts on Kimi K3?

I have recently been burning through my Max 5x plan in about 3 days, even when using skills that delegate tasks to Sonnet and Opus, the plan just doesn't seem to go very far anymore. I was consider...

skill
by Spooknik Jul 23, 2026 5/10
skill Reddit

Codex Computer Use Skill

submitted by /u/lyndon050516 [link] [comments]

skill
by lyndon050516 Jul 23, 2026 5/10
skill Reddit

Superpower takes too long and consumes too much token

I've been using the superpowers skills for writing the specs, plan and executing it via subagent-driven-development. However, the execution time takes about 1 hour. Life seems Life seems much simpl...

skill
by Jealous-Mammoth-5526 Jul 23, 2026 6/10
skill Reddit

How to understand existing codebase?

How do you approach understanding new codebases? If you are new to a codebase and you want to understand it better based on existing components, services, controllers and repos (also maybe git log?...

skillgit
by devmaterialized Jul 23, 2026 8/10
skill Reddit

Fable Credits Burn Speed Question: Serious

Please respond with objective experience, I'm not looking to fuel judgement. Setting aside "skill issue" entirely as a variable, is it possible the complaints about Fable allotment being used up in...

skill
by KSSLR Jul 23, 2026 8/10
skill Reddit

Someone please unplug Anthropic’s keyboards for 5 minutes

i haven't even finished testing one feature and they’ve already dropped four more. managed agents, ios simulator, screen recording agent skills, security scanner... slow down guys i'm not an ai (ye...

skilltesting
by Several-Lemon-3381 Jul 23, 2026 7/10
skill GitHub

pdlc-skills: 36 Slash Commands Turning Claude Code Into a Full PDLC Workflow

A comprehensive set of 36 slash commands that enforce a structured Product Development Lifecycle in Claude Code — PRD → TDD → implement → review → ship. Hard contracts force the AI to persist artifacts, write failing tests first, and run self-checks before claiming completion.

slash-commandstddworkflowpdlcquality-gateslifecycle
by kanfu-panda Jul 22, 2026 9/10
skill GitHub

claude-club-motion-library-skill: 547 Animated UI Recipes as a Claude Skill

A comprehensive skill containing 547 animated website sections, app templates, backgrounds, gradients, and design-system recipes accessible through Claude Code. Provides production-quality animation patterns via natural language prompting.

animationuidesignskillcomponentstemplates
by Samin12 Jul 22, 2026 6/10
skill Reddit

multi-agent-chatter: Coordinate Multiple Claude Code Tabs Without Manual Relay

A Claude Code skill that assigns one tab as the PM owning the project roadmap while worker tabs handle specialized tasks in parallel. Tabs communicate through a shared internal board, eliminating manual copying of updates between sessions. Works best with 4-5 worker tabs on a single repository.

multi-agentcoordinationpmshared-boardparalleltabs
by The___Storyteller Jul 22, 2026 7/10
skill GitHub

frontend-scaffolding: Skill for Project Structure Before AI Implements Any Pages

A Claude Code skill that enforces setting up a proper frontend project structure before implementing any individual pages. Prevents the common anti-pattern where AI generates pages ad-hoc, leading to growing inconsistency and complexity in frontend codebases.

frontendscaffoldingskillstructurearchitecture
by Byron569 Jul 22, 2026 6/10
skill GitHub

TOP-SKILLS: Largest Claude Code Skill Hub — 3900+ Skills from 12+ Sources

The largest known aggregation of Claude Code skills, collecting over 3,900 skills from 12+ sources with an online search interface and trend analysis dashboard. A one-stop reference for discovering and evaluating community-contributed Claude Code skills.

skillsaggregationsearchcommunityindexdashboard
by bg-szy Jul 22, 2026 9/10
skill GitHub

Custom Skills for Academic Writing, Automation, and Specialized Workflows

A collection of custom Claude Code skills targeting academic writing workflows, task automation, and specialized use cases beyond standard coding assistance. Covers domain-specific tasks that fill gaps in the standard Claude Code skill set.

skillsacademic-writingautomationworkflowsspecialized
by xjsongphy Jul 22, 2026 5/10
skill GitHub

onboard: Claude Code Skill That Catches Your README Lying

A Claude Code skill that follows README setup documentation literally in a clean environment, reporting every setup step that is wrong, missing, or silently assumed. Turns README validation from a manual chore into an automated, reproducible test.

readmedocumentationtestingonboardingvalidationskill
by tokyubevoxelverse Jul 22, 2026 8/10
skill GitHub

necromancer: Claude Code Skill That Resurrects Dead Repos

A Claude Code skill that takes broken repositories that no longer build and fixes the dependencies, patches breaking changes, and brings them back to life. Automates the tedious work of modernizing stale or abandoned codebases.

dependencieslegacyrepairmodernizationskilldead-repos
by tokyubevoxelverse Jul 22, 2026 8/10
skill GitHub

bowtie-funnel-resources: Reusable Skills for Organizing AI Agent Folders

A set of reusable skills for AI coding agents focused on organizing the agent folder into a clean, filesystem-first layout. Provides structural conventions for managing skills, memory, and configuration across multiple projects.

skillsorganizationfilesystemstructureconventions
by bowtiefunnel Jul 22, 2026 5/10
skill GitHub

Niche-Claude-Code: Battle-Tested Skills for Claude Code and Cowork

A collection of battle-tested skills for Claude Code and Cowork that claims to double usage at the same quality level. Targets power users looking to maximize throughput from their AI coding sessions.

skillscoworkproductivity
by M4NUSH7 Jul 22, 2026 5/10
skill Reddit

Claude Code Skill: Fetch Real SVG Icons from Iconify Instead of Hand-Drawing

A Claude Code skill that prevents the AI from generating SVG icons from scratch. Instead, it pulls production-quality icons from the Iconify library, improving output quality and eliminating token waste on iterative icon attempts.

svgiconsiconifyskillui
by Dependent-Cake-8034 Jul 22, 2026 7/10
skill Reddit

Skills for Visual PRs, Specs, and Repo Documentation with Staleness Checks

A set of Claude Code skills that make pull requests and repository documentation more visual and informative. Includes staleness checks to automatically flag outdated docs and specs so project documentation stays current as code evolves.

documentationpull-requestsspecsstalenessvisual
by scottyroges Jul 22, 2026 6/10
skill GitHub

JD.SemanticKernel.Extensions: Claude Code Skills with Semantic Memory

Semantic Kernel extensions for Claude Code that add skills, hooks, context compaction, and semantic memory. Allows Claude Code agents to store and retrieve semantically relevant context across sessions using vector memory. Useful for long-running projects where persistent knowledge is important.

semantic-kernelmemorycontextskills
by JerrettDavis Jul 21, 2026 7/10
skill GitHub

Lamina: Headless Product Design Skill for AI Coding Agents

A headless product design skill for AI coding agents that separates the design phase from implementation. It helps agents reason about how a feature should work before writing any code, then verifies that what ships matches the design intent. Reduces drift between spec and implementation.

designverificationworkflowskills
by aryaniyaps Jul 21, 2026 7/10
skill GitHub

claude-skills: Open Claude Skills for Go-to-Market Teams

A collection of open Claude Code skills targeting sales and marketing workflows—HubSpot, Salesforce, Clay, cold email, LinkedIn, and outbound automation. Skills install via npx or by copying into .claude/skills/. Targets GTM engineers and revenue teams who want AI-native tooling.

gtmsalesmarketingskillshubspotsalesforce
by Growth-Today Jul 21, 2026 6/10
skill GitHub

gtm-skills: AI Skills for Revenue Engineering in Claude Code Format

Reusable Claude Code skills covering the go-to-market engineering stack: ICP research, brand voice, signal-driven outbound, positioning, lead scoring, and RevOps automation. Built in Claude Code skill format for direct installation. Targets revenue teams building AI-native GTM workflows.

gtmrevenuesalesskillsoutbound
by esmefong Jul 21, 2026 6/10
skill GitHub

Skilldex Registry: Community Registry for Claude Code Skills and MCPs

A community-maintained registry of Claude Code skills, subagents, and MCP servers. Serves as the data store backing the skilldex CLI tool. Centralizes discovery of community-built extensions rather than requiring searches across individual GitHub repos.

registryskillsmcpdiscoverycommunity
by drewn-ed Jul 21, 2026 7/10
skill GitHub

Skilldex: Search, Install, and Audit Claude Code Skills from the CLI

A CLI tool for searching, installing, validating, and auditing Claude Code skills, subagents, and MCP servers from the skilldex community registry. Makes it easy to discover and safely add community extensions without manual copy-paste. Includes validation to catch broken or malformed skills before installation.

cliskillsinstallvalidationmcp
by drewn-ed Jul 21, 2026 8/10
skill GitHub

Claude Code Eyes: Camera Vision Skill for Hardware Debugging

A skill that gives Claude Code access to a live camera feed so it can see real hardware, displays, and wiring. Enables verification of rendered UI on physical screens, wiring checks before power-on, and catching bugs that only manifest on glass rather than in logs. Novel capability for embedded and electronics projects.

visioncamerahardwaredebuggingskills
by fcavalcantirj Jul 21, 2026 8/10
skill GitHub

Topos: Sync Shared Agent Behaviors Across Your Team

A CLI and self-hostable control plane for sharing agent skills and behaviors across a team. Keeps every agent up to date with the latest shared conventions without manual file copying. Useful for organizations where multiple developers run Claude Code and need consistent agent behavior.

teamskillssyncworkflowcollaboration
by topos-sh Jul 21, 2026 7/10
skill Reddit

Agentic Avengers: Multi-Agent Dev Workflow Skills with Character Personalities

A set of Claude Code skills with Avengers character personalities for autonomous, consistent development workflows. Highlights include /assemble (idea → spec → plan → build → PR) and /loki (full codebase analysis producing a MECHANICS.md file). Battle-tested in open-source projects.

skillsmulti-agentworkflowautomationorchestration
by Far_Noise_5886 Jul 21, 2026 7/10
skill GitHub

Retail Investor Skills Plugin: 26 Claude Code Skills with Live Market Data

A Claude Code plugin with 26 skills for reading companies, sectors, and personal trading journals. Backed by live market data from The Balanced Investor Club. Explicitly educational—never buy or sell advice. Useful for investors who want AI-assisted fundamental research without building their own data pipeline.

financeinvestingskillsmarket-data
by the-balanced-investor-club Jul 21, 2026 6/10
skill GitHub

Debrief Skill: Post-Session Agent Performance Review

A Claude Code skill that reviews how a session went—not what code it produced. It identifies mistimed questions, regressions introduced, and wasted tool calls so you can improve prompting and CLAUDE.md configuration. Unique meta-review perspective that complements code review.

metareviewsessionskillsimprovement
by Wavez Jul 21, 2026 8/10
skill GitHub

yt2skill: Turn YouTube Videos and PDFs into Claude Code Skills

A tool that converts a YouTube video or PDF into a ready-to-use Claude Code skill. Transcript-first approach: Claude selects only video frames that carry information not conveyed in the transcript. Useful for packaging tutorial content or documentation as reusable agent skills.

skillsyoutubepdfcontentconversion
by MrEmanAhmad Jul 21, 2026 8/10
skill GitHub

First Principles Skill: 5-Phase Systematic Reasoning for Claude Code

A Claude Code plugin for structured first-principles thinking with a 5-phase methodology: identify essence, challenge assumptions, establish ground truths, reason upward, and validate. Every conclusion traces back to a verified ground truth. Comes with 13 companion skills for specific reasoning tasks.

reasoningskillsmethodologyfirst-principles
by chrisdavidson Jul 21, 2026 8/10
skill GitHub

Blueprint: Adaptive Concept-Builder with Interface Contracts Before Coding

A Claude Code skill that builds a module-oriented blueprint with interface contracts, schema validation, and cross-consistency checks before any implementation code is written. Prevents the common failure mode of coding toward a poorly specified interface. Produces a structured plan the agent can execute against.

planningarchitectureskillscontractsdesign
by motodigitalguru-beep Jul 21, 2026 7/10
skill GitHub

ai-skills: Production-Ready Skills for Claude Code and Multi-Agent Systems

A collection of production-ready skills for Claude Code and multi-agent systems. Targets developers who want battle-tested skill building blocks rather than starting from scratch. Covers common patterns for reliable agent behavior in production environments.

skillsproductionmulti-agentworkflow
by AreteDriver Jul 21, 2026 6/10
skill Reddit

My Full Claude Code Setup: CLAUDE.md, Skills, Permissions, Hooks

A comprehensive walkthrough of a real-world Claude Code configuration covering CLAUDE.md structure, custom skills, permission settings, and automation hooks. Useful as a reference for practitioners assembling their own setup.

CLAUDE.mdskillspermissionshookssetup
by Distinct_Setting558 Jul 21, 2026 6/10
skill GitHub

claude-code-skills: Reusable Skills for Express, OWASP Audits, Security, and TTS

A collection of reusable Claude Code slash command skills covering Express microservice scaffolding, OWASP security audits, security hardening checklists, and TTS generation. Drop-in skills for common development and security workflows.

skillsecurityexpressowaspttsmicroservice
by lantisprime Jul 21, 2026 7/10
skill Reddit

twq: Claude Code Skill That Asks Clarifying Questions Before Acting

A 24-line Claude Code skill (Task With Questions) that makes Claude study your request, ask multi-round clarifying questions to surface assumptions, and only then execute. The author reports using it more than any other skill.

skillclarificationquestionsworkflowux
by fabpub Jul 21, 2026 8/10
skill GitHub

lateralus: Skill That Forces Lateral Thinking When You're Stuck on a Bug

A Claude Code skill for when you've tried the same fix three times and it keeps failing. It forces the model to explore genuinely different approaches rather than iterating on the same failed idea.

skilldebugginglateral-thinkingproblem-solving
by SunnyKTuladhar Jul 21, 2026 7/10
skill GitHub

brand-book: Skill to Build Brand Guidelines and Keep Agentic Code On-Brand

An agent skill that generates a brand guidelines document in a Paper format, plus a companion brand skill that the agent references during coding sessions to keep product output visually and tonally consistent.

skillbranddesignguidelinesconsistency
by ordinarynerds Jul 21, 2026 6/10
skill GitHub

dootask-skills: Claude Code Skills for DooTask Plugin Development

A set of Claude Code skills for DooTask plugin development: scaffold a new plugin, publish to the app store, and write an optimized CLAUDE.md. Install via /plugin install dootask@dootask-skills.

skilldootaskpluginscaffold
by dootask Jul 21, 2026 5/10
skill Reddit

What is your favourite Fable build?

Hello! I like many of you have been messing around with Fable. I optimized my workflows, updated my skills, and built a programming interface to brush up on my Python and SQL skills. But my favouri...

skillworkflowpythonreview
by CanaryHorror2404 Jul 21, 2026 5/10
skill GitHub

ai-launch-red-team: Skill to Red-Team AI Launch Plans Before Production

Agent skill that evaluates AI deployment plans against 8 veto conditions before they reach a live workflow. Works with Claude Code, Cursor, and Codex. Good guardrail for teams wanting an adversarial review step before shipping AI-powered features.

red-teamsecurityskilldeploymentai-safety
by Anonymousyz Jul 21, 2026 7/10
skill GitHub

known-unknowns: Agent Skill for Guided Exploration of the Rumsfeld Knowledge Matrix

Skill that facilitates structured discussions about what you know, what you know you do not know, and what you do not know you do not know — based on the Rumsfeld Matrix. Helps articulate vague ideas and surface blind spots when starting a project or debugging complex issues.

skillknowledge-managementproblem-solvingideation
by Wang-Cankun Jul 21, 2026 5/10
skill Reddit

I built a tool to help me improve my listening skills :D

It It takes short clips from captioned YT videos and turns them into dictation or fill-in-the-blank exercises. You replay a clip, type what you heard, and it highlights the differences :) If you wa...

skillgit
by nice-to-meet-you-bro Jul 21, 2026 5/10
skill GitHub

seedance-shotlist-director: Claude skill: script → Seedance 2.0 production board

Claude skill: script → Seedance 2.0 production board in one prompt | Клод-скилл: сценарий → продакшн-борд для Seedance 2.0 — режиссёрские промпты, ENDS ON склейки, @ассеты, риск-бюджет кредитов, тр...

skill
by afloy011-spec Jul 21, 2026 6/10
skill Reddit

Flame my attempt at building ClaudeCode Skills.

I want you guys to flame the two skills I built with ClaudeCode: https://github.com/AnayDhawan/components https://github.com/AnayDhawan/oss-launch Please Flame as accurately as possible, as I wanna...

skillgit
by NKFBF Jul 21, 2026 6/10
skill Reddit

Anybody using https://github.com/HKUDS/OpenSpace ?

I have a bunch of skills in my claude skillset, and I came across https://github.com/HKUDS/OpenSpace which acts a sefl evolving engine for skills, anybody have used it or at least can see the long ...

skillgit
by jiii95 Jul 21, 2026 6/10
skill Reddit

Kimi Sold out as demand rising

https://preview.redd.it/f757xid75beh1.png?width=2056&format=png&auto=webp&s=4d1c4de4f51c841d0ed1762f7418650a6f3b4ae6 Kimi K3 (China AI model that distilled the anthropic model that doesn't even exi...

skillreview
by pakalumachito Jul 21, 2026 6/10
skill GitHub

benai-skills:

benai-skills:

skill
by naveedharri Jul 21, 2026 5/10
skill GitHub

maestro: Unified Design, Motion, 3D, and Video Super Skill for AI Coding Agents

Distills eight upstream knowledge bases — covering design, motion, 3D, and video — into a single super skill for AI coding agents. Includes automated upstream drift tracking so the skill stays current as its sources evolve. Aimed at agents that need deep creative-toolchain context without juggling multiple skill files.

skilldesignmotion3Dvideoknowledge-basedrift-tracking
by leobbaroni Jul 20, 2026 7/10
skill GitHub

ai-context: Portable AI-Agnostic Agent Context, Skills, and Role Guidance

Personal portable context repository with agent skills and role-based guidance designed to work across different AI coding agents, not just Claude Code. Drop it into any new project to bootstrap consistent agent behavior without reconfiguring from scratch.

skillcontextportableagnosticroles
by Jean-PierreGassin Jul 20, 2026 5/10
skill GitHub

merge-unified-skills: Claude Code Skills for the Merge Unified API

Official Claude Code skills from the Merge team for working with their Unified API, which normalizes integrations across ATS, HRIS, CRM, and other HR and business tool categories. Lets agents interact with dozens of third-party platforms through a single skill interface.

skillmerge-apiintegrationsunified-apihrisats
by merge-api Jul 20, 2026 6/10
skill GitHub

agent-skills: Portable Reusable Skills Shared Across Codex and Claude Code

Single-source skill repository designed for portability across both Codex CLI and Claude Code, with validation-first design and CC Switch integration for seamless management. Provides a home for reusable skills that work identically across coding agents without duplication.

skillportablecodexcross-clivalidationcc-switch
by reagin Jul 20, 2026 5/10
skill GitHub

econ-paper-review-skill: AI Referee Report for Economics Papers Before Real Review

Claude Code / Codex skill that generates verified referee-style feedback on economics, finance, and social science papers before they go to a real reviewer. Produces verifiable comments, editing notes, and a revision plan that agents can implement. Free for noncommercial use, built for iterative revision cycles.

skilleconomicspaper-reviewacademicrefereerevision
by hanlulong Jul 20, 2026 6/10
skill GitHub

skill-olympus: 98 Skills + 49 Agents + 13 Hooks for a Zero-Interaction SaaS Pipeline

Massive cross-CLI skill collection (Claude Code, Codex, Gemini CLI) themed around twelve Greek gods, each covering a domain of the full SaaS lifecycle from design to ship. A single command runs the entire pipeline — design, build, inspect, test, deploy — with cross-CLI persistent memory and no manual steps. The largest known public skill collection for AI coding agents.

skillagenthooksaaspipelinecross-clicomprehensive
by Dannykkh Jul 20, 2026 8/10
skill GitHub

skills: Traditional Chinese Writing and Business Doc Skills for Claude Code

Claude Code skill collection for Traditional Chinese (Taiwan) writing tasks: de-AI editing, business document templates, and professional writing guidance. Also includes English infographic and knowledge-doc skills. Useful for teams working in Traditional Chinese who want agent-assisted document production.

skillchinesewritingbusiness-docstaiwantraditional-chinese
by leoluyi Jul 20, 2026 5/10
skill GitHub

coloring-book-skill: Printable Kids Coloring Books via Claude Code

A Claude Code skill that generates personalized printable coloring books for children ages 3-6. Supports parametric character creation, a story mode, a shape cookbook for simple designs, and vector PDF output. Creative demonstration of using Claude Code skills for media generation workflows.

skillPDFcreativekidsvector
by bedardandy Jul 19, 2026 6/10
skill GitHub

job-hunter-template: AI Job-Search Assistant as a Claude Skills Package

A ready-to-clone template that turns a single GitHub repo into a full personal job-search assistant using Claude Skills. Covers guided onboarding, persistent profile storage, multi-source job sourcing, fit evaluation, tailored CV generation, and application tracking — all version-controlled and inspectable. No personal data included in the template.

skilljob searchtemplateworkflowCV
by FynePool Jul 19, 2026 7/10
skill GitHub

django-performance-optimizer: Agent Skill for Fast Django/DRF Code

A Claude Code agent skill focused on Django and Django REST Framework performance. Follows a measure-first, fix-second approach, with deep coverage of ORM query optimization, serializer efficiency, caching strategies, async patterns, and connection pooling. Complements the separate secure-code-auditor skill and works with Claude, Codex, Cursor, and Gemini.

skillDjangoDRFperformanceoptimizationPython
by n-shadloo Jul 19, 2026 7/10
skill GitHub

html-mockup: Pixel-Faithful HTML Mockups from a Reference Screenshot

A Claude Code skill that takes a reference screenshot and produces a pixel-faithful HTML mockup. Uses a census-first approach — cataloguing all visual elements before rendering — to improve fidelity. Useful for design-to-code handoff workflows where visual accuracy matters.

skilldesignmockupHTMLscreenshot
by humbleteam Jul 19, 2026 6/10
skill GitHub

ascii-wireframes: Sketch 3 Layout Hypotheses in ASCII Before Touching Figma

A Claude Code skill for design teams that generates three distinct ASCII wireframe layout hypotheses before committing to Figma or HTML. Encourages divergent thinking early in the design process, letting teams compare layout directions cheaply before investing in higher-fidelity tools.

skilldesignwireframeASCIIlayoutUX
by humbleteam Jul 19, 2026 7/10
skill GitHub

design-review: Scored UX Critique Skill with Nielsen/WCAG Citations

A Claude Code skill that performs structured UX critiques of your UI, producing scored findings with Before/After/Why fixes and citations to Nielsen heuristics and WCAG accessibility guidelines. Bridges the gap between AI-generated interfaces and design quality standards.

skillUXaccessibilityWCAGNielsendesign review
by humbleteam Jul 19, 2026 8/10
skill GitHub

skillevel: YAML-Based Test Runner for Claude Code Skills

Write YAML test cases for your Claude Code skills and run them through `claude -p` to verify each skill triggers as expected. Fills the gap in skill development — you can now test skill activation behavior the same way you test code.

testingskillsyamlciskill-development
by junghwan16 Jul 19, 2026 8/10
skill GitHub

go-to-damn-bed: A Claude Code Skill That Saves Your Work and Sends You to Sleep

A Claude Code skill that interrupts late-night coding sessions, saves current work state into TOMORROW.md, and firmly tells you to go to bed — without accepting counter-offers. Practical context-preservation wrapped in a bit of humor.

skillsworkflowcontextproductivitysession-management
by moudrkat Jul 19, 2026 7/10
skill GitHub

off-by-none: Spec-Faithful Implementation Skill with Mandatory Boundary Coverage

Claude Code skill that enforces spec-derived tests, mandatory boundary coverage, and evidence-gated done reports before marking work complete. Every rule is TDD-tested against real baseline failures on Opus, Sonnet, and Haiku to ensure the enforcement actually holds.

skillstddtestingspecquality
by NTCHz Jul 19, 2026 8/10
skill GitHub

claude-lore: Project Memory Skill for Decisions and Dead Ends

Claude Code skill that records project state, design decisions, and dead ends that live outside the codebase itself. A new session can resume with full context by reading the lore file instead of re-reading code to reconstruct intent.

memorycontextskillsession-managementknowledge
by sh008 Jul 19, 2026 6/10
skill GitHub

pythinker-code: Review-First Shell Loop for Code, Security, and Debugging

A shell-native tool that enforces a think-first, review-first approach where Claude Code and Codex typically jump straight to writing. Combines a code reviewer, security scanner, root-cause debugger, and code generator in one loop. Slows down to produce more reliable output.

skillreviewsecuritydebuggingcode-qualityshell
by Pythoughts-labs Jul 19, 2026 7/10
skill Reddit

Architecture-Reviewer Skill: Senior-Engineer-Style Design Reviews

A full SKILL.md for Claude Code that stress-tests system architectures across failure domains, scalability, data consistency, security, operability, and cost — prioritizing findings by blast radius. Includes test-driven validation: the author planted 8 deliberate flaws and it found all 8. Ready to drop into ~/.claude/skills.

skillarchitecturesecurityscalabilityreview
by Swimming_Year5735 Jul 19, 2026 9/10
skill GitHub

ai-sync: Sync AI-Agent Config Across Claude Code, Codex, and Kiro

Syncs AI coding agent configuration from a single .ai directory to Claude Code, Codex, and Kiro. Maintains one source of truth for agent configuration and distributes it to all installed agents. Reduces drift when using multiple coding agents on the same machine.

skillconfigurationsynccodexkiromulti-agent
by dialguiba Jul 19, 2026 6/10
skill GitHub

creative-strategy-research-protocol: Audience Research via TikTok and Meta Ads

A gated research protocol for Claude Code built on the MaxFusion AI MCP that pulls real TikTok and Meta Ad Library creatives, analyzes them against Eugene Schwartz's 5 Stages of Awareness, mines voice-of-customer signals, and compiles everything into a persistent research memory tree plus an HTML dossier with personas.

skillmarketingresearchmcppersonasstrategy
by holy-templar Jul 19, 2026 5/10
skill Reddit

prompt-polish: Model-Specific Prompt Rewriter Skill

Rewrites prompts using the official Anthropic guide for the specific target model (Fable 5, Opus 4.8, etc.) rather than a generic template. Classifies the task type and applies model-specific idioms — less prescription for Fable 5, tight scope for Opus. Install via npx skills add mfarzanansari/prompt-polish.

skillprompt-engineeringfable5opus
by imfarzann Jul 19, 2026 8/10
skill GitHub

skillcaddy: Central Library for AI Skills With Per-Project Symlinks

Maintains one AISkills folder with every skill source and symlinks them on demand into any project's .agents/skills or .claude/skills. Works across Claude Code, Codex, OpenCode, and Pi. Eliminates duplication when sharing skills across many repos.

skillskills-managementmulti-agent
by chenweil Jul 19, 2026 6/10
skill GitHub

baseline-skill: Zero-Dependency Project-Readiness Checker (69 Rules)

A /baseline slash command skill that audits a project against 69 readiness rules with no external dependencies. Installs into ~/.claude/skills/baseline. Surfaces gaps like missing README, untested modules, or missing CI configuration before work begins.

skillproject-healthqualityaudit
by AdarGit008 Jul 19, 2026 7/10
skill GitHub

zotero-dev-rules: Zotero Developer Docs as a Coding-Agent Skill

Packages Zotero developer documentation — Web API v3 (read/write, sync, streaming, OAuth), client JS API, Zotero 7 plugins, translators, and CSL citation styles — as a coding-agent skill. Enables agents to write Zotero integrations without hallucinating the API.

skillzoteroapidocumentation
by Agents365-ai Jul 19, 2026 6/10
skill GitHub

forgekit: Unified Config and Cognitive Substrate for All AI Coding Agents

Provides one configuration layer covering Claude Code, Codex, Cursor, Gemini, Aider, and more, plus a cognitive substrate for memory, blast-radius tracking, and guardrails. Reduces per-agent setup overhead when using multiple coding agents on the same project.

skillmulti-agentconfigurationguardrails
by CodeWithJuber Jul 19, 2026 7/10
skill GitHub

techne: Nine Claude Skills for Multi-Repo Workflows

A collection of nine Claude Code skills targeting multi-repository development: audit builds, tame CI, sync docs to code, and keep sister repos in lockstep. Useful for monorepo-adjacent setups where consistency across repos matters.

skillmulti-repocidocumentation
by ajbarea Jul 19, 2026 6/10
skill GitHub

mentor: Session-Insights Skill That Reports How You Work

Reads local Claude Code and OpenAI Codex session history and writes an HTML report on what you build, where you lose time, and concrete workflow improvements. Surfaces patterns like repeated tool failures or overlong context usage. Works with Claude Code, Codex, and any skills-capable agent.

skillanalyticsproductivitysession-analysis
by smixs Jul 19, 2026 7/10
skill GitHub

skills-manager: Claude Code Skill for Managing Skills, MCPs, and Plugins

A meta-skill for Claude Code that helps manage the growing collection of skills, MCP servers, and plugins by organizing them into categories. Useful as the Claude Code ecosystem grows and managing dozens of installed skills becomes difficult.

skillskills-managementmcporganization
by Xue-Sir Jul 19, 2026 6/10
skill GitHub

slop-cop: Detect AI-Generated Language Patterns in Your Codebase

A Claude Code skill that scans a codebase for AI-writing tells — overused phrases, filler words, passive constructions — to ensure human-quality prose in comments, docs, and strings. Grounded in common AI writing anti-patterns.

skillcode-qualitywritingai-detection
by Lucasli6833 Jul 19, 2026 5/10
skill GitHub

claude-code-learned-skills: 12 Skills Auto-Extracted From Real Sessions

Twelve Claude Code skills distilled from actual usage sessions, covering Docker/SSH/VPS operations, data and ML pipeline gotchas, model-specific prompting guides for four models, a 10-category bug audit, and a persistent project wiki with slash commands. Real-world extraction means these address actual pain points.

skilldockersshvpsmlprompting
by aksheyw Jul 19, 2026 8/10
skill GitHub

cc-thingz: Portable Skills, Agents, Hooks, and Pi Extensions

A collection of portable skills, agents, hooks, and Pi extensions for Claude Code, Codex CLI, Copilot, Cursor, Grok, and Pi. Cross-tool design means the same skills work regardless of which AI coding agent you're using.

skillmulti-agenthooksportable
by alexei-led Jul 19, 2026 6/10
skill GitHub

Claude-Liquid-Glass-Skill: iOS Liquid Glass UI for Swift and React Native

A Claude Code skill for generating iOS Liquid Glass design components in Swift and React Native. Helps developers implement Apple's Liquid Glass aesthetic with AI assistance. Platform-specific but covers two of the main mobile development ecosystems.

skilliosswiftreact-nativedesign
by zakisheriff Jul 19, 2026 5/10
skill GitHub

openwolf-enhanced: Token-Conscious Second Brain for Claude Code

An enhanced fork of OpenWolf that adds bounded storage, self-maintenance via an 'openwolf doctor' command, .wolfignore scoping for excluding files from context, and tunable retention policies. Addresses the original OpenWolf's lack of storage limits. AGPL-3.0.

skillmemorycontexttoken-optimization
by bassprofressor-lab Jul 19, 2026 7/10
skill GitHub

cad-khana: Claude Code Skill for LLM-Driven CAD With Build123d

A Claude Code skill and diagnostics-first wrapper around Build123d for LLM-driven 3D CAD iteration. Surfaces Build123d error messages in a form the model can act on, enabling back-and-forth CAD design workflows. For developers who work on parametric 3D modeling.

skillcadbuild123d3d-modeling
by cyberchitta Jul 19, 2026 6/10
skill GitHub

research-code-skill: AI Coding Standard for ML/DL Research Repos

A coding-standard skill that enforces a fixed architecture for ML/DL research repositories: uniform structure, naming conventions, configuration standards, FAIR data practices, and review via machine-executable Rule Cards. Prevents the common drift in research code as multiple contributors (human and AI) add to it.

skillmlresearchcode-standardsfair-data
by SaltGardenia Jul 19, 2026 7/10
skill GitHub

design-brief: Extract a 5-Bullet Design Brief From Messy Project Inputs

A Claude Code skill that takes messy project inputs (stakeholder notes, Figma links, PDFs) and distills them into a structured 5-bullet design brief plus a gap report identifying missing information. Useful at the start of any design or product project.

skilldesignuxproduct
by humbleteam Jul 19, 2026 6/10
skill GitHub

design-handoff: Turn a Mockup Into a Dev-Ready Handoff Spec

Converts a UI mockup into a developer-ready handoff specification covering design tokens, component states, accessibility notes, and open questions. Bridges the gap between designers and developers in AI-assisted workflows. Part of the humbleteam design skill collection.

skilldesignhandofftokensaccessibility
by humbleteam Jul 19, 2026 7/10
skill GitHub

accessibility-audit: WCAG 2.2 Audit Skill for Claude Code

A Claude Code skill that performs WCAG 2.2 accessibility audits on web UIs, returning severity-ranked findings with success-criterion citations. Integrates accessibility review into the coding agent workflow without requiring a separate tool.

skillaccessibilitywcagauditweb
by humbleteam Jul 19, 2026 7/10
skill GitHub

claude-plugins: Marketplace With Per-Worktree Plugin Loadouts

A small Claude Code plugin marketplace with its first entry: loadout, which lets you activate a different set of plugins per git worktree. Useful when different branches or projects need different skill/agent configurations without global setting changes.

skillpluginsworktreeconfiguration
by TerryHong97 Jul 19, 2026 6/10
skill GitHub

mnemo: Persistent Memory Layer for Claude Code With Obsidian Integration

Five lightweight skills providing an Obsidian vault health checker, connection discovery, brain dump, session notes, and an email bridge. CLI-first with no prescribed taxonomy — works with any knowledge structure. Bridges Claude Code sessions to a persistent Obsidian knowledge base.

skillmemoryobsidiannotespersistence
by jojoprison Jul 19, 2026 7/10
skill GitHub

claude-homelab-skills: Safe Homelab Admin Skills for Claude Code

Claude Code skills for homelab administration emphasizing safety: Tailscale ACL validation with anti-lockout protection, and Proxmox snapshot-before-write for any destructive operation. Adds judgment (not just tools) to prevent accidental self-lockout during AI-assisted homelab management.

skillhomelabtailscaleproxmoxsafety
by Enzojol Jul 19, 2026 7/10
skill GitHub

agenticaiplugin: Language-Agnostic Claude Code Plugin for Code Reviews and Audits

A Claude Code plugin that adds multi-specialist code reviews, architecture audits, QA traceability, smart git commits, and GitHub release preparation. Project-specific rules in claudedocs/ take precedence over built-in guidelines. Language-agnostic.

skillcode-reviewarchitectureauditrelease
by mka-codelake Jul 19, 2026 7/10
skill GitHub

skill3: Java CLI That Auto-Generates Agent Skills From Documentation

Discovers documentation sources for a given technical skill, scores them for authority and freshness anchored to a model's knowledge cutoff, synthesizes them into an Agent Skills SKILL.md using a local LLM, and vets the result with NVIDIA SkillSpector. Automates the creation of skills from live docs.

skilldocumentationauto-generationjavalocal-llm
by PIsberg Jul 19, 2026 7/10
skill GitHub

helix: Portable QA Skill Pack for AI Coding Agents

A portable QA skill pack covering frontend and API test-case preparation (AC/EC + Swagger coverage review), Playwright ticket testing, defect filing, and Jira retest. Works across Claude Code, Cursor, Codex, GitHub Copilot, Gemini CLI, Windsurf, Cline, and other Agent Skills-compatible tools.

skillqaplaywrightjiraswaggertesting
by Thitic9203 Jul 19, 2026 7/10
skill GitHub

Blender-Developer-Tools: Skills and Examples for Blender Python Development

A collection of skills, rules, code snippets, templates, and smoke-gated runnable examples for Blender Python development, targeting Blender 5.1 with 4.5 LTS fallback. Enables Claude Code to write verified Blender Python without hallucinating the API.

skillblenderpython3dcreative-coding
by TMHSDigital Jul 19, 2026 6/10
skill GitHub

skills-hub: See Which AI Agent Skills Actually Get Used From Session Logs

A local web UI that reads Claude Code, Codex, and OpenCode session logs to count which skills actually get triggered in practice. Surfaces underused skills and helps prioritize which ones to maintain. Zero-dependency, local-only.

skillanalyticsusage-trackingsession-logsoptimization
by Liang-HZ Jul 19, 2026 8/10
skill GitHub

awesome-solo-ai: Curated AI Tools and Claude Skills for Solopreneurs

A curated collection of AI tools, Claude skills, MCP servers, and growth playbooks for solopreneurs and indie hackers — structured as a feed-to-Claude-Code context package. Covers the one-person-company AI stack from product to marketing.

skillsolopreneurcuratedmcpgrowth
by yerdaulet-damir Jul 19, 2026 5/10
skill GitHub

claude-ops: Business Operating System for Claude Code (57 Skills, 21 Agents)

A comprehensive business operating system built on Claude Code with 57 skills, 21 agents, and a smart daemon. Covers unified inbox (WhatsApp/Email/Slack/Telegram), autonomous PR merge, full-AWS monitoring, Stripe, Shopify, Klaviyo, Meta, GA4, voice (Bland/ElevenLabs), and APM (Datadog/NewRelic/OTEL).

skillbusinesssaasmonitoringintegrationsautomation
by Lifecycle-Innovations-Limited Jul 19, 2026 8/10
skill GitHub

uzys-agent-harness: Curate Vetted AI Coding Skills by Tech Stack

A tool for selecting and installing only the AI coding skills relevant to your specific tech stack, from a vetted collection compatible with Claude Code, Codex, OpenCode, and Antigravity. Reduces noise from installing large skill packs that include irrelevant skills.

skillcurationtech-stackmulti-agent
by uzysjung Jul 19, 2026 5/10
skill GitHub

swe-workbench-loom: Senior Engineer AI Toolkit for Go/Rust/TypeScript

A 2026 senior engineer AI toolkit implementing Clean Architecture principles for Go, Rust, and TypeScript development. Provides structured patterns for AI-assisted development in these three languages with architecture-first guidance.

skillgorusttypescriptclean-architecture
by amoh7209-dot Jul 19, 2026 6/10
skill GitHub

i-have-adhd: Claude Code Skill for ADHD-Friendly, Bottom-Line-First Output

A Claude Code skill that instructs the model to stop burying the answer — lead with the conclusion, then the reasoning. Practical for any user who finds Claude Code's verbose, reasoning-first responses hard to skim. MIT-licensed, single-file skill.

skilladhduxconcisenessoutput-format
by ayghri Jul 19, 2026 7/10
skill GitHub

califa-cards: Comprehensive Skill Card Standard and Testing Framework

A specification and testing framework for AI agent skill cards — a standard format for describing, testing, and distributing agent skills. Provides a structured way to ensure skill cards are complete, testable, and portable across agents.

skillstandardtestingskill-cardsportability
by vinsonconsulting Jul 19, 2026 6/10
skill GitHub

abvx-agent-skills: Reviewable Capability Layer With Delivery Gates and Verification

A capability layer for coding agents emphasizing reviewability: portable skills, delivery gates, workflow patterns, and verification-first engineering. Designed so every agent capability can be inspected and its outputs verified before acceptance.

skillverificationdelivery-gatesportablequality
by markoblogo Jul 19, 2026 6/10
skill GitHub

stripe-design-skill: Color-Agnostic Stripe Design System Skill for Claude Code

A Claude Code skill that encodes the Stripe design system in a color-agnostic form, letting you apply Stripe's spacing, typography, and component patterns to any brand palette. Drop it in and Claude Code follows Stripe's UI conventions without being locked to Stripe's specific colors. Useful for building polished dashboards and payment UIs quickly.

stripedesignuiskilldesign-systemcomponents
by victoryoalli Jul 19, 2026 6/10
skill GitHub

vscode-crash-recovery-skills: Agent Skills for Safe VS Code Crash Recovery on macOS

Harness-neutral Agent Skills for recovering from VS Code crashes and cleaning up project-scoped build artifacts on macOS without data loss. Works with any agent that supports Skills (Claude Code, etc.). Handles the edge cases — zombie processes, locked files, stale build caches — that make crash recovery error-prone manually.

skillvscodecrash-recoverymacoscleanupagent
by ariellephan Jul 19, 2026 5/10
skill GitHub

claude-todos-skill: Per-Project Todo Tracking With Broadsheet Dashboard

Per-project todo tracking combined with a project brain and autonomous plan-then-build workflow for Claude Code, with a local broadsheet dashboard. Integrates task management directly into the agent workflow rather than as a separate tool.

todostask-managementskilldashboardplanning
by unknown Jul 18, 2026 7/10
skill Reddit

speedread-skill: Read Agent MD Reports 3.5x Faster With RSVP

Skill that renders Markdown documents using RSVP (Rapid Serial Visual Presentation) speedreading, enabling up to 6x faster reading with practice. Settings (colors, fonts, speed, ramp-up, markdown tweaks) are saved across sessions. Useful when reviewing long agent-generated reports.

readingrsvpspeedskillproductivity
by heisdancingdancing Jul 18, 2026 6/10
skill GitHub

ad-campaign-skills: Production-Grade Paid Media Skills for Claude Code

Production-grade paid-media agents and skills for Claude Code that generate complete ad campaigns for any industry and region from a 4-line client brief, covering Meta, Google, YouTube, and TikTok. Designed for agencies and marketers running ad operations through Claude Code.

marketingadvertisingskillmetagoogle-ads
by rghrmkr1993 Jul 18, 2026 6/10
skill GitHub

olddonkey-skills: Codex-Implementation-Loop for Claude + Codex Pairing

Agent skills distilled from real-world usage featuring the codex-implementation-loop: delegate coding to Codex while keeping review, gate, and ship judgment in Claude hands. A practical pattern for pairing the two most popular coding agents with clear separation of responsibilities.

codexpairingskillreviewdelegation
by olddonkey Jul 18, 2026 6/10
skill GitHub

claude-skill-aso-reviews: Turn App Store Reviews Into ASO Insights

Claude Code skill that turns Apple App Store reviews into App Store Optimization and product feedback insights. Automates the process of reading and categorizing user reviews at scale to surface actionable product insights.

asoapp-storereviewsskillproduct
by johnisanerd Jul 18, 2026 6/10
skill GitHub

claude-skill-congress-trading: Track Congress Trading Disclosures

Claude Code skill that tracks newly filed US Congress trading disclosures on a schedule via CLI, installed via npx skills add. Automates monitoring of congressional stock trading activity for research and alerting workflows.

financecongressdisclosureskillmonitoring
by johnisanerd Jul 18, 2026 6/10
skill GitHub

claude-skill-congress-stocks: Congress Stock Trade Disclosures as JSON

Claude Code skill that retrieves US Congress stock trade disclosures as structured JSON via CLI. Complementary to the congress-trading-tracker, providing a data access layer rather than a monitoring scheduler.

financecongressjsonskillapi
by johnisanerd Jul 18, 2026 6/10
skill GitHub

Claude Code Plugin: EDA + Event Sourcing + Azure Functions Harness

Claude Code plugin providing a harness for event-driven architecture with event sourcing on Azure Functions. Pre-built scaffolding and conventions for this specific backend pattern, reducing the time needed to set up a correct EDA implementation from scratch.

azureevent-sourcingedaserverlessskill
by augusto-romero-arango Jul 18, 2026 6/10
skill GitHub

ui-ux-audit-skill: Audit UI Code for Layout Failures and Design Drift

Audits web and mobile UI code to detect layout failures, responsiveness errors, and design system drift before deployment. Catches the class of issues that code linters miss but visual inspection would catch, giving agents a way to self-audit UI quality.

uiauditresponsivenessdesign-systemskill
by Xza2792 Jul 18, 2026 6/10
skill GitHub

zero-sugar: Honesty Mode for Claude Without Politeness Padding

Configures Claude to deliver damage-ranked findings with evidence per criticism, calibrated confidence, and no politeness padding. Useful when you need direct critical feedback rather than diplomatically softened analysis, especially in code review or debugging scenarios.

honestyfeedbackskillcode-reviewdirectness
by edward-sh88 Jul 18, 2026 6/10
skill GitHub

contentforge: Enterprise Content Production Plugin With 21 Skills

Open-source enterprise content production plugin with 21 skills, 13 agents, 11 quality gates, a 29-pattern AI humanizer, fact-checker, and real .docx output with C2PA signing for EU AI Act Article 50 compliance. Works across Claude Code, Cowork, Codex, Cursor, and Copilot CLI.

contententerpriseskillcompliancedocx
by indranilbanerjee Jul 18, 2026 6/10
skill GitHub

inner-outer-monologue: Two-Layer Reasoning Discipline for Claude

Establishes a two-layer reasoning discipline where clauses carry explicit output obligations and failures are auditable clause by clause. Makes Claude reasoning more transparent and verifiable by separating internal reasoning from external output commitments.

reasoningtransparencyskillauditclauses
by duncan806 Jul 18, 2026 6/10
skill GitHub

hiccai-landing: Claude Code Skill for High-Conversion Landing Pages

Claude Code skill for high-conversion landing pages covering strategy, copy, design, motion, runnable HTML, with built-in SEO and GEO support including llms.txt, FAQ JSON-LD, and AI-crawler readiness. Includes bilingual support (English/Chinese).

landing-pageseogeoskillhtml
by laixi969-coder Jul 18, 2026 6/10
skill Reddit

176k-Starred GitHub Repo Changed How I Write CLAUDE.md

Post exploring how insights from a 176k+ starred GitHub repository changed the approach to writing CLAUDE.md configuration files. Demonstrates how ideas from adjacent communities can meaningfully improve Claude Code configuration practices.

claude-mdconfigurationtipsbest-practices
by Single-Cherry8263 Jul 18, 2026 6/10
skill Reddit

Playbook: One Plugin Repo Running on 5 Agents Simultaneously

How to make a single plugin repository work on Claude Code, Codex, OpenCode, Hermes, and Antigravity at once without duplicating skill definitions. Addresses the growing need to maintain skills across multiple agent runtimes as developers use more than one tool.

plugincross-agentcodexhermescompatibility
by No_Skill_8393 Jul 18, 2026 6/10
skill GitHub

dehumanize: Make AI Work Like AI, Not a Human Assistant

Skill and configuration that removes human-oriented behaviors from Claude: no time estimates, no asking for accessible data the agent can fetch itself, no emotional labor. Designed for autonomous agent workflows where human-like hedging and hand-holding wastes tokens and slows execution.

skillbehaviorautonomousefficiency
by ssplug Jul 18, 2026 6/10
skill GitHub

user-md: USER.md That Grows With Your AI Interactions

A USER.md file with two lanes: hand-written and agent-curated, with no silent rewrites from the agent side. The AI builds up its understanding of you in a file you own and control, that moves when your folder moves. Gives the agent persistent user context without surrendering control.

memoryuser-profilemarkdownagent-memory
by LucioLiu Jul 18, 2026 6/10
skill GitHub

claude-office-skills: Excel and PowerPoint Automation for Claude Code

Imports Excel and PowerPoint skills into Claude Code to automate spreadsheets and presentations using local filesystem access. Useful for developers who need to generate or modify Office documents as part of automated workflows.

excelpowerpointofficeautomationskill
by Borjani1577 Jul 18, 2026 6/10
skill GitHub

agent-second-brain: Dynamic Knowledge System for Claude Code Agents

Builds a dynamic knowledge system for Claude Code agents that evolves over time with the ability to test and manage information. Designed to give agents a persistent second brain that improves with use rather than starting from scratch each session.

knowledgememorydynamicskill
by benizlerken Jul 18, 2026 6/10
skill GitHub

claude-nomad: Sync Full Claude Code Setup Across Machines

Syncs your complete Claude Code setup across machines: skills, settings, and session history, with path remapping and per-host overrides. Addresses the pain of maintaining consistent Claude Code configuration when working across multiple machines or cloud environments.

synccross-machinesettingsskillshistory
by funkadelic Jul 18, 2026 8/10
skill GitHub

agentmaster: Expensive Head, Cheap Hands Workflow for Claude Code

Claude Code and GitHub Copilot skills implementing an expensive head/cheap hands pattern — a master decision-maker on a frontier reasoning model that never touches the repository, commanding subagent workers that do all reading, running, and writing with adversarial gates at both ends.

multi-agentorchestrationadversarialcost-efficiency
by rhawk117 Jul 18, 2026 7/10
skill GitHub

skill-press: Factory for Claude Code Skills — Nothing Ships Untested

A factory for Claude Code skills where nothing ships without being tested. Enforces a review and testing process for every skill before publication, addressing the quality problem in the growing ecosystem of unvetted skill packages.

skilltestingqualityfactory
by proluct Jul 18, 2026 7/10
skill GitHub

collapse: Pattern-to-SKILL.md Compiler for Claude Code

Compiles patterns from MDX lessons, Jupyter notebooks, or custom sources into SKILL.md files via a type-safe pipeline with local atomic writes to ~/.claude/skills/. Three pluggable ingestors let you convert any learning material into Claude Code skills.

skillcompilerjupyterautomationmdx
by akaieuan Jul 18, 2026 8/10
skill GitHub

saas-skills: Agent Skills for Shipping SaaS on Next.js + Supabase

Agent skills covering the full SaaS lifecycle: product definition, secure build-and-launch, and safe maintenance on Next.js, Supabase, and Stripe. Works with Claude Code, Codex, and Antigravity. Opinionated toward security and correctness at each stage.

saasnextjssupabasestripeskill
by Naveen-95 Jul 18, 2026 7/10
skill GitHub

claude-code-skills: Curated Catalog of Verified Working Skills

Hand-verified catalog of working Claude Code skills covering marketing, SEO, dev, and MCP — with no dead links. Also ships a built-in 19-sub-skill SEO/GEO agent ready to use. Addresses the frustration of finding skill collections where half the links are broken or unmaintained.

skillcatalogseoverifiedmarketplace
by nurdamiron Jul 18, 2026 7/10
skill GitHub

skill-creator-plus: Bug-Fixed Anthropic Skill Creator With Cowork Support

Based on Anthropic official skill-creator but with bug fixes, working Cowork support, and official best practices baked in. A Claude skill for creating, testing, and improving other Claude skills. Useful when the original has issues that prevent it from working properly with Cowork.

skillmetaskill-creatorcowork
by yaniv-golan Jul 18, 2026 8/10
skill Reddit

LLM Wiki: Installable Skill for Building a Persistent Knowledge Brain

Implementation of Andrej Karpathy LLM Wiki pattern as an installable Claude skill plus BLUEPRINT.md spec. Instead of RAG, the LLM builds and maintains a persistent Markdown wiki from your sources — read once, cross-reference forever, flag contradictions. Key rule: if the brain has no coverage, it says so rather than inventing an answer.

knowledge-basewikiskillmarkdownkarpathy
by PromptFiction Jul 18, 2026 8/10
skill GitHub

goldilocks: Lean Superpowers Replacement for Coding Agents

Minimal-process, constant-quality alternative to Superpowers for coding agents. Focuses on minimum necessary workflow to maintain consistent output quality, avoiding the complexity and overhead that accumulates in larger skill frameworks. Available in both English and Chinese.

skillworkflowsuperpowerslightweight
by blackstone2333 Jul 18, 2026 7/10
skill GitHub

claude-sync-by-skill: Sync Claude Code Environment Across Platforms

Directional, cross-platform, transport-agnostic sync for Claude Code settings, memory, plans, and skills driven by an in-Claude skill. Supports up/down/status operations and works regardless of the underlying transport mechanism.

synccross-platformsettingsskills
by JonMcMillan Jul 18, 2026 7/10
skill GitHub

agent-plugins: Plugin Marketplace for Claude Code and Cowork

Curated plugin collection for Claude Code and Claude Cowork featuring fresh-eyes code review agents, workflow orchestrators, and specialized skills. Emphasizes independent review — agents that have not seen the original implementation evaluate the output from a fresh perspective.

plugincode-reviewmarketplaceworkflow
by aliasunder Jul 18, 2026 7/10
skill GitHub

skill-builder: Build Reusable Skills From Shell and Claude Logs

Analyzes shell, git, browser, and Claude logs to spot recurring patterns and convert them into installable slash commands in your AI tools. Automates the process of turning repetitive workflows into reusable agent skills.

skillautomationslash-commandpatterns
by izzidescendent834 Jul 18, 2026 7/10
skill GitHub

skill-sync: Desktop App That Syncs Agent Skills Across Machines

Local-first desktop app that syncs Codex, Claude Code, and Agent Skills across machines through your private GitHub repository. Solves the problem of maintaining consistent skill configurations when working across multiple development machines.

syncskillscross-machinegithub
by TreatTrick Jul 18, 2026 7/10
skill GitHub

claude-skills: Docker and Kubernetes Skills for Autonomous Agents

Production-ready Docker and Kubernetes tooling packaged as Claude Code skills with built-in validators. Install once and use everywhere for container management and Kubernetes operations from within your agent workflows. Modular and independently verifiable.

dockerkubernetesskilldevopscontainers
by obeone Jul 18, 2026 7/10
skill Reddit

onebreath: Slash Commands for Concise Claude Responses

Tiny Claude Code plugin adding /onebreath:1s for one-sentence responses and /onebreath:1p for one-paragraph responses. Solves the common problem of Claude producing walls of text when you just need a quick answer. Especially useful in multi-session setups where brevity matters.

skillconcisecommandux
by louixs Jul 18, 2026 7/10
skill GitHub

neuralmind: Persistent Memory That Learns Codebase Like a Senior Engineer

Persistent memory for AI coding agents that learns which files go together and what you usually edit next, the same way a senior engineer builds intuition. Works with Claude Code, Cursor, Cline, and Continue, running 100% locally. Reportedly reduces code question costs by 40-70x.

memorycodebaselocal-firstcostcontext
by dfrostar Jul 18, 2026 7/10
skill Reddit

VibeCurb: Strict SKILL.md Files to Kill Generic AI-Generated UI

Collection of strict skill.md files that kill the generic glassmorphism and rounded-corner spam in AI-generated UIs. Enforces viewport-scale typography, brutalist design, and extreme whitespace, forcing the agent to think like an Awwwards-tier designer before writing code. Works with Claude, Cursor, ChatGPT, Codex, and Gemini.

uidesignskillbrutalismcss
by AudienceNo2554 Jul 18, 2026 7/10
skill GitHub

bastra-recall: Local-First Memory Vault Shared Across AI Tools

Local-first persistent memory for Claude Code, Cursor, ChatGPT, and any MCP client — one Markdown vault shared across every AI tool. Keeps all context in files you own and control, with no vector database or cloud service required.

memorymarkdownlocal-firstmulti-tool
by n0mad-ai Jul 18, 2026 7/10
skill GitHub

better-github-skill: Optimized GitHub Skill With Fewer Tool Calls

Drop-in replacement for standard GitHub skills that makes bounded, targeted calls: one call each for PR state, review threads, and CI failures. Reduces context burned and cost compared to naive approaches that over-fetch GitHub data. Works with any coding agent.

githubskilltokensefficiencypr
by AVGVSTVS96 Jul 18, 2026 7/10
skill GitHub

scholia: Git-Native Product Memory With Claude Code Skills

Single binary tool for storing action-driven specs and append-only decision records that AI agents can evaluate code changes against. Includes a built-in viewer and Claude Code skills for integration. Keeps product intent inside git alongside the code it governs.

memoryspecdecision-recordsgit
by nkenji09 Jul 18, 2026 7/10
skill GitHub

Agentic Memory Stack for Claude Code on Windows + WSL2

Persistent, multi-tier, measurably-faithful memory backend for Claude Code on Windows and WSL2, combining mem0, Qdrant, EmbeddingGemma, and Codex. Self-contained operator-agnostic installer skill. Designed for Windows-first environments where other memory setups fall short.

memorywindowswsl2qdrantskill
by dmmdea Jul 18, 2026 7/10
skill GitHub

ai-brain-starter: Operating System Layer for Claude Code

Comprehensive one-install foundation for Claude Code providing memory, accountability, journaling, knowledge graphs, and pattern recognition. Designed so every session compounds on the last by building up persistent understanding of projects and decisions. Installs everything in one command.

memoryknowledge-graphjournalingskillclaude-code
by mycelium-hq Jul 18, 2026 8/10
skill GitHub

web-scraping-skills: Authorized Web Scraping via CDP for Claude Code

Claude Code skill marketplace for attaching to a logged-in Chrome over CDP and harvesting JSON/GraphQL data that pages already fetch. Includes anti-block hygiene and resumable state. Designed for authorized scraping scenarios where you control the browser session.

web-scrapingcdpchromeskill
by brightstone111 Jul 18, 2026 7/10
skill GitHub

poor-man-memory: Claude Code Memory in Markdown and Git

Stores structured Claude Code memory in markdown files tracked by git — no extra infrastructure required. Provides cross-session memory with the simplicity of plain text and the history of version control. Zero dependencies and works on any machine with git already installed.

memorymarkdowngitclaude-codeno-infrasimple
by huckaby1847 Jul 18, 2026 6/10
skill GitHub

video-ai-toolkit: Give Your AI Agent Full Control Over Videos

Gives AI coding agents full control over videos — download with yt-dlp (MP4/MP3), watch with claude-real-video, and transcribe with speaker diarization via WhisperX. All local, Portuguese-language documentation. Claude Code skills and compatible agent skills included.

skillvideotranscriptionyt-dlpwhisperxclaude-code
by JohnsonChenx Jul 18, 2026 6/10
skill GitHub

crag: Bedrock Governance Layer for AI Coding Agents

A single governance.md bedrock layer for AI coding agents that works across any project and never goes stale. Compiles to Claude, Cursor, Codex, Gemini, and Aider-compatible formats from one source. Universal skills mean you write the governance rules once and they work everywhere.

governanceCLAUDE.mduniversalskillsclaude-codecodexcursor
by WhitehatD Jul 18, 2026 7/10
skill GitHub

skills: 19 Composable Pipeline-First Skills for Feature Delivery

A pipeline-first Claude Code skills pack with 19 composable skills for structured feature delivery from shape to ship. Each skill fits into a delivery pipeline stage so you can chain them together. Designed for teams who want an opinionated but flexible feature delivery process.

skillspipelinefeature-deliverycomposableclaude-code
by chrislacey89 Jul 18, 2026 7/10
skill GitHub

akakika-skills: Curated Agent Skills for Building Native Apps

Curated, polished agent skills for building calm native apps and running AI coding agents well. Works with Claude Code, Codex, and Cursor. Focused on native app development patterns and calm, deliberate workflows rather than rapid vibe coding.

skillsnative-appsclaude-codecodexcursorquality
by aka-kika Jul 18, 2026 6/10
skill GitHub

ren-os: Agentic OS for Claude Code With Compounding Memory

An agentic OS for Claude Code featuring compounding memory you own, token discipline, and governed autonomy — all in a plain-markdown wiki as your single source of truth. Named after the Chinese concept of benevolence, it focuses on thoughtful, deliberate agent behavior rather than speed.

memoryAI-OSclaude-codetoken-efficiencymarkdowngovernance
by hazarsozer Jul 18, 2026 7/10
skill GitHub

chameleon: Guide AI-Generated Code to Match Your Team Conventions

Automatically analyzes your codebase to learn conventions, then guides AI-generated code to follow team idioms, architectural patterns, and best practices — keeping auto-generated code in sync with evolving standards. A living conventions engine that updates as your codebase evolves.

skillconventionscode-qualitystandardsclaude-codeteam
by crisnahine Jul 18, 2026 8/10
skill GitHub

trigger_tree: Documentation-Discovery Telemetry for Claude Code

A documentation-discovery telemetry skill for Claude Code that generates heat/cold maps, health grades, and evidence-backed router fixes for your documentation system. Runs 100% locally with zero tokens. Helps you understand which parts of your CLAUDE.md are actually being used.

skilldocumentationtelemetryCLAUDE.mdlocalanalytics
by Hedde Jul 18, 2026 7/10
skill GitHub

google-ads-diagnostic-toolkit: 10 Claude Skills for Google Ads Diagnostics

Ten production Claude skills covering the full Google Ads diagnostic lifecycle — waste detection, spend spikes, Quality Score analysis, budget management, and reporting. Built from real campaign management experience. Useful for marketers and agencies who want AI-assisted Google Ads analysis.

skillgoogle-adsmarketingdiagnosticsPPCanalytics
by kochellenk-afk Jul 18, 2026 7/10
skill GitHub

claude-marketing-skills: Claude Skills From a Working Fractional CMO

Production Claude skills from a working fractional CMO practice covering client sweeps, critique layers, decision councils, and Meta ad engines. Built from real consulting engagements. Useful for marketing practitioners and agencies who want AI-assisted marketing strategy and execution.

skillmarketingCMOstrategymeta-adsconsulting
by kochellenk-afk Jul 18, 2026 6/10
skill GitHub

martech-ai-skills: Claude Skills for the Marketing Technology Stack

Claude skills and read-only CLIs for the marketing-technology stack — covers martech teardown, Google Ads, Microsoft Ads, and Google Merchant Center. Built for practitioners who want AI-assisted analysis of their marketing tech without giving write access to ad accounts.

skillmarketinggoogle-adsmartechanalyticsclaude-code
by almoretti Jul 18, 2026 6/10
skill GitHub

shakedown: One-Command Pre-Ship Audit Skill for Claude Code

A one-command shakedown skill for Claude Code that checks architecture, security, performance, resilience, and docs before you ship. Surfaces what breaks before your users find it. Useful as a final gate before merging or deploying.

skillauditsecurityperformancepre-shipclaude-code
by belousov-petr Jul 18, 2026 7/10
skill GitHub

claude-code-setup: Real Claude Code Global CLAUDE.md and Skills Shared

A shared real-world Claude Code setup — global CLAUDE.md instructions and the skills built and used daily by the author. Good reference for what production Claude Code configuration looks like from an experienced user. MIT licensed for copying and adapting.

CLAUDE.mdsetupskillsconfigurationreferenceclaude-code
by cozren Jul 18, 2026 6/10
skill GitHub

repo-standard-toolkit: Scaffold Repo Docs From Published Standards

Scaffolds README, CHANGELOG, and community health files from published standards (Keep a Changelog, standard-readme, Contributor Covenant) and keeps them accurate with a committed, dependency-free linter and CI gate. The linter runs without Claude so standards are enforced in CI as well.

skilldocumentationreadmechangelogstandardsCI
by runverdict Jul 18, 2026 7/10
skill GitHub

addlightness: Remove AI-Generated Code Fat While Preserving Behavior

A zero-dependency Claude Code plugin that simplifies and removes bloat from AI-generated code while preserving behavior, then benchmarks the speedup. Measures code weight, trims it, verifies equivalence, and benchmarks the result. Useful for cleaning up verbose AI output that works but is heavier than it needs to be.

skillrefactoringoptimizationclaude-codecode-quality
by 88plug Jul 18, 2026 7/10
skill GitHub

project-prospector: Discover and Rank Everything You Have Built

A read-only two-pass parallel sweep that discovers, catalogs, and ranks every project or sketch on your machine by novelty and leverage. Helps you find forgotten projects that are worth continuing or extracting ideas from. Good for developers with many scattered experiments who want an inventory.

skilldiscoveryprojectsrankingproductivityclaude-code
by 88plug Jul 18, 2026 6/10
skill GitHub

forge-skills: Document-Driven AI Dev Framework With 14 Skills

A document-driven AI development framework with 14 skills covering the full cycle from brainstorm through PRD, design, engineering, QA, review, shipping, and retrospective. Bilingual (English/Chinese). Provides a complete structured process for product development using AI agents.

skillworkflowproduct-developmentTDDPRDclaude-code
by yike-gunshi Jul 18, 2026 7/10
skill GitHub

senior-engineering-partner: Stack-Agnostic Code Review and Mentorship Skill

A stack-agnostic Claude Code skill acting as a strict code reviewer, pair programmer, debugger, and mentor for Python, Bash, Apps Script, and JavaScript. Security-first with a spec→plan→TDD→verify workflow and phase-aware engineering discipline. Useful for solo developers who want a senior engineer perspective on their work.

skillcode-reviewmentorshipTDDsecurityclaude-code
by bjgreenberg Jul 18, 2026 7/10
skill GitHub

Claude-Code-CyberSecurity-Skill: 15 Skills for Security Professionals

A comprehensive collection of 15 Claude Code skills for cybersecurity professionals covering offensive security, defensive operations, reverse engineering, threat hunting, CSOC automation, and more. Built for practitioners who want AI-assisted security workflows. Covers the full security operations lifecycle.

skillsecuritycybersecurityoffensivedefensiveclaude-code
by Masriyan Jul 18, 2026 7/10
skill GitHub

open-zk-kb: Zettelkasten-Based Shared Memory for AI Assistants

A shared, persistent memory system for AI assistants built on the Zettelkasten method — creates interconnected notes with backlinks rather than isolated memory entries. Implements slip-box-style knowledge management that grows more useful as your agent adds to it. Useful for research-heavy workflows.

memoryzettelkastenknowledge-baseAI-assistantspersistent
by mrosnerr Jul 18, 2026 6/10
skill GitHub

app-store-review-skill: Audit iOS Apps Before App Store Review

A Claude Code skill for auditing iOS and iPadOS apps before App Store Review, recovering from rejections, and catching low-effort craft signals that reviewers flag. Helps developers pass App Store review faster by catching common rejection reasons before submission.

skilliOSapp-storereviewauditmobile
by ElxMaj Jul 18, 2026 6/10
skill GitHub

AI-SKILLS: Plug-and-Play Skills for All AI Coding Agents

A comprehensive plug-and-play collection of AI skills and prompts for Claude Code, Claude Desktop, Cursor, Antigravity, OpenAI Codex, Gemini CLI, and every major AI coding agent. All in portable SKILL.md format with a browser-based Prompt Builder. Single repository that works everywhere.

skillscross-agentportableSKILL.mdpromptsclaude-code
by Amey-Thakur Jul 18, 2026 7/10
skill GitHub

scientific-method: Falsification-First Workflow for Claude Code

A falsification-first investigation and invention workflow for Claude Code featuring hypothesis ledgers, controlled experiments, REFUTE-first verification, and provable invention. Encodes the scientific method into an agent skill so Claude approaches problems empirically rather than jumping to conclusions.

skillscientific-methodhypothesisverificationclaude-code
by 88plug Jul 18, 2026 7/10
skill GitHub

drive-remote-terminal: Drive a Remote TUI Over SSH From Claude Code

A skill for driving an interactive full-screen TUI on a remote machine over tmux/screen + SSH using a type-wait-screenshot-read loop. Enables Claude Code to operate remote applications that do not expose an API. Useful for AI-assisted sysadmin tasks on remote machines with terminal-only interfaces.

skillremoteSSHTUItmuxautomationsysadmin
by 88plug Jul 18, 2026 7/10
skill GitHub

skill-x: Open-Source Agent Skills for Claude Code and Other Agents

Open-source agent skills for Claude Code, Codex, GitHub Copilot, and other coding agents — features GPT-5.6-style rigor, delegation patterns, linear probes, and self-evolving workflows. A general-purpose skill collection that covers common development tasks across multiple agent runtimes.

skillsclaude-codecodexcopilotopen-source
by anshmajumdar121 Jul 18, 2026 6/10
skill GitHub

skills-runtime: Minimal Agent Skills Runtime from the Google Whitepaper

A minimal Agent Skills runtime implementing the Google/Kaggle whitepaper pattern behind Claude Skills — folders of SKILL.md, cheap catalog routing, progressive disclosure, and bundled deterministic scripts. Also runs free local Ollama models. Good for understanding how Claude Code skills work under the hood.

skillsruntimeskill.mdclaude-codeollamawhitepaper
by syedahmad0786 Jul 18, 2026 7/10
skill GitHub

cman: Agentic Memory for Claude Code

A lightweight agentic memory system specifically for Claude Code that gives your agent persistent recall across sessions. Simple to set up with minimal dependencies. Good starting point for users who want session memory without the complexity of a full MCP-based solution.

memoryclaude-codepersistenceskill
by laiso Jul 18, 2026 6/10
skill GitHub

recover-from-false-positive: Recover Claude Sessions After Classifier Blocks

A tool for recovering Claude Code sessions after an Anthropic API output-classifier false positive. JSON-aware JSONL log surgeon that removes the triggering message and refusal turn, re-stitches the parent UUID chain so the session resumes cleanly. Also installs a per-repo CLAUDE.md framing guard.

recoveryfalse-positivesessionjsonlclaude-codeCLAUDE.md
by 88plug Jul 18, 2026 7/10
skill GitHub

trigger-my-training: Ground-First Reflex Skill for Claude Code

A skill that makes Claude Code judge task complexity from its own training and ground itself before acting — then hard-blocks the irreversible step until grounding is complete. Prevents rushed execution on complex tasks by enforcing a think-first gate. Useful for high-stakes automated workflows.

skillsafetygroundingclaude-codecomplexity
by 88plug Jul 18, 2026 6/10
skill GitHub

total-recall: Cross-Session, Cross-CLI Memory for AI Coding Assistants

Cross-session, cross-CLI memory for AI coding assistants with data-driven operator discovery from your own transcripts. Includes 23 MCP tools, 5 hooks, 15 commands, and 8 CLI adapters. One of the most comprehensive memory systems available for Claude Code users who switch between tools.

memorycross-sessionmcphooksclaude-codetranscripts
by 88plug Jul 18, 2026 8/10
skill GitHub

lore: Capture Non-Obvious Learnings While Coding, Auto-Recall Next Time

A plugin for Claude Code and Codex that captures non-obvious learnings as you code and automatically recalls relevant ones the next time you hit a similar situation. Builds a personal knowledge base of hard-won insights without requiring you to manually document them. Passive and lightweight.

memorylearningskillclaude-codecodexknowledge-base
by aoc81 Jul 18, 2026 8/10
skill GitHub

speedread-skill: RSVP Reader for AI Codebase Reports

An agent skill plus a one-file RSVP reader for markdown reports — your AI agent reads the codebase and you speedread the report using rapid serial visual presentation. Makes consuming long AI-generated codebase analysis much faster. Useful for large codebases where the analysis output itself is substantial.

skillreadingRSVPcodebasereportsproductivity
by jordan-gibbs Jul 18, 2026 6/10
skill GitHub

supskill: Sprint Conductor for Claude Code From Backlog to Merged Branch

A sprint conductor skill for Claude Code that drives one sprint from a markdown backlog to a merged branch — fresh context per stage, three human gates, all state stored on disk. Provides structure for multi-day or multi-session sprints without losing progress. Inspired by physical sprint ceremonies.

skillsprintworkflowbacklogclaude-codegit
by bessavagner Jul 18, 2026 7/10
skill GitHub

rails-consultant: Skills for Rails Development and Consulting

A collection of Claude Code skills for Rails development and consulting with emphasis on learning, communication, and client success. Built by the thoughtbot team with production Rails consulting experience. Useful for Rails developers who want battle-tested patterns encoded into skills.

skillrailsrubyconsultingthoughtbotdevelopment
by thoughtbot Jul 18, 2026 6/10
skill GitHub

wheel-to-talk: Voice-to-Text for Claude Code via Middle Mouse Button

Hold the middle mouse button to dictate voice-to-text input into Claude Code on Windows. A zero-friction way to add voice input without switching apps or using hotkeys. Useful for accessibility or for users who prefer speaking prompts over typing.

voiceinputwindowsclaude-codeaccessibilityplugin
by Pr1m4lc0d3 Jul 18, 2026 7/10
skill GitHub

memroos: Memory OS and Governance Layer for AI Agent Workflows

A memory OS and governance layer for AI agents covering workflows, dispatch, proof, and context continuity. Provides structured memory management that goes beyond simple file storage to include governance policies and proof mechanisms. Useful for teams building auditable AI workflows.

memorygovernanceAI-agentsworkflowcontext
by lac5q Jul 18, 2026 6/10
skill GitHub

dotnet-senior-skills: Senior .NET Review Rules for AI Coding Agents

A collection of senior-level .NET review rules for AI coding agents compiled from a single source into Claude Code skills, Cursor rules, and Copilot instructions. Covers Spring AI, threading, performance, and security patterns. Useful for .NET teams who want consistent, expert-level code review across their AI tools.

skilldotnetcode-reviewclaude-codecursorcopilot
by Sarmkadan Jul 18, 2026 6/10
skill GitHub

mkpub: Generate the Four Files Every Public Repo Needs

Generates README.md, LICENSE.md, SECURITY.md, and llms.txt from a scan of your repo — never inventing facts, no guessed licenses, no fabricated benchmarks. A Claude Code skill with 8 modes, 7 protocols, and 4 bundled figlet fonts. Solves the tedious task of writing accurate public-facing repo documentation.

skilldocumentationreadmelicensesecurityllms.txt
by ndisisnd Jul 18, 2026 7/10
skill GitHub

quality-loop: AI Reviews, Scores, Revises, and Blind-Checks Its Own Work

A quality pipeline skill for Claude Code where the AI reviews, scores, revises, and blind-checks its own output before delivering it to you. Implements a structured self-review loop that catches common mistakes the model would otherwise miss. Particularly useful on high-stakes outputs where a second pass matters.

skillqualityself-reviewclaude-codepipeline
by gavinzzc Jul 18, 2026 7/10
skill GitHub

research-kit: Shared Infrastructure for AI-Assisted Research Workflows

Shared infrastructure for AI-assisted research workflows including Claude Code skills, conventions, methodology documents, and tools. Provides a structured starting point for researchers using AI coding agents in academic or analytical work. Designed to be composable with other skill sets.

skillresearchacademicworkflowclaude-code
by hsigstad Jul 18, 2026 6/10
skill GitHub

ultra-goal: Multi-Agent Orchestration Skill for Unattended Long Tasks

A multi-agent orchestration skill for Claude Code designed for unattended, long-running engineering tasks. Manages task delegation, coordination, and completion across multiple sub-agents without requiring a human to stay in the loop. Useful for overnight or weekend agent runs.

skillmulti-agentorchestrationunattendedclaude-code
by Azure99 Jul 18, 2026 7/10
skill GitHub

modelese: Lexicon and Linter for AI-Generated Jargon

A lexicon, linter, and rewrite gate for the private dialect AI coding agents develop on long runs — scores, blocks, and rewrites AI jargon into plain language. CC0 dictionary so anyone can contribute. Addresses the real problem of model outputs becoming increasingly opaque and unreadable over long sessions.

skilllinterjargonlanguagequalityclaude-code
by YunyueLi Jul 18, 2026 6/10
skill GitHub

skill-scout: Evaluate Claude Code Skill Repos Before Installing

A skill that acts as your CTO for evaluating AI skill repos — paste a link, get a straight verdict: install it, cherry-pick parts, or skip it entirely. Reads every file in the repo so you do not have to evaluate raw skill quality yourself. Saves time when browsing the growing skill ecosystem.

skillevaluationcode-reviewclaude-codecuration
by wallmage Jul 18, 2026 7/10
skill GitHub

mif-docs-plugin: Skill Suite for All Major Documentation Genres

A MIF-first documentation skill suite for Claude Code covering eight document genres: Diataxis, ADR, RFC/PEP, runbook, PRD, Kiro, arc42/C4, and changelog. Implements structured documentation from MIF Level 1 to Level 3. Provides one skill per genre so you can generate well-structured docs without switching tools.

documentationskillclaude-codeadrrunbookprd
by modeled-information-format Jul 18, 2026 7/10
skill GitHub

skills: Daily-Driver Coding-Agent Skills Managed with the vd CLI

A curated daily-driver collection of skills for agentic coding, managed with the vd CLI tool. Designed to be portable and agent-agnostic so the same skills work across different AI coding assistants. The companion vd CLI makes it easy to install, update, and manage skills as versioned packages.

skillsclaude-codecodexvd-cliportable
by vanducng Jul 18, 2026 7/10
skill GitHub

llm-wiki-template: Knowledge Base Your AI Agent Maintains for You

A domain-agnostic LLM-wiki template for Claude Code where the AI agent maintains and updates the knowledge base as you work. MIT licensed, it gives your agent a living reference document that stays current without manual upkeep. Solves the problem of context files drifting out of date.

memoryknowledge-baseclaude-codecontextskill
by JX-29 Jul 18, 2026 6/10
skill GitHub

mckinsey-style-visualization-skill: Strategy Visuals From Notes

An agent skill that turns messy notes into rendered strategy-consulting-style visuals with SVG output and validation. Produces McKinsey-style charts and frameworks from plain text input. Useful for product managers, consultants, and analysts who want polished visualizations without manual design work.

skillvisualizationSVGstrategyconsulting
by kgraph57 Jul 18, 2026 6/10
skill GitHub

dumb-it-down: Plain-Language Rewriter for Dense Agent Plans

An agent skill that translates dense coding-agent plans into plain, decision-focused language with everyday analogies. Strips jargon and technical framing while keeping the stakes clear so non-technical stakeholders can follow along. Useful when you need to communicate AI-generated plans to a broader audience.

skillcommunicationplanninglanguagesimplification
by breadoncee Jul 18, 2026 6/10
skill GitHub

concilium: Cross-Model Adversarial Review With GPT Probing

A cross-model adversarial review skill for Claude Code where Fable orchestrates and GPT (via Codex CLI) probes for weaknesses. Verdicts are ratified through a structured disagreement process. Works without an API key using your ChatGPT subscription, making multi-model code review accessible.

code-reviewmulti-modeladversarialskillclaude-codegpt
by raichominev Jul 18, 2026 7/10
skill GitHub

shape-plan: Turn Vague Needs Into Bounded, Execution-Ready Plans

A universal agent skill that converts vague requirements into structured, bounded, execution-ready plans. Optimized for Codex but works across agent runtimes including Claude Code. Helps avoid the common problem of agents building in the wrong direction because the spec was underspecified.

skillplanningspeccodexclaude-code
by xscanzm Jul 18, 2026 6/10
skill GitHub

build-better-skills: Suite of Skills for Creating Better Skills

A meta-skill suite for building better Claude Code skills — covers creation, installation, auditing, releasing, regression testing, and sediment removal. Provides a structured lifecycle for skill development so your skills do not rot over time. Essential for anyone building and maintaining a skill library.

skillmetadevelopmentlifecycletestingclaude-code
by Songhonglei Jul 18, 2026 7/10
skill GitHub

claude-code-starter-kit: Discipline and Security Starter Kit for Claude Code

A starter kit that keeps Claude Code on course across sessions with repo-based memory that survives context compaction, enforced hooks and permissions, and a phased workflow. Designed for teams who want consistent, traceable, secure AI coding sessions. Can be cloned standalone or installed as a plugin.

starter-kitsecurityhooksmemoryclaude-codeworkflow
by muratsilahtaroglu Jul 18, 2026 8/10
skill GitHub

session-save-system: Four /session Commands for Claude Code

Provides four slash commands for Claude Code — tag, save, summary, and audit — that rename messy AI chats and remember what they did. Stores session records as plain markdown on your Desktop so you can find past work without digging through JSONL files. Simple and zero-dependency.

skillsessionmemoryclaude-codecommandsmarkdown
by youkistudios Jul 18, 2026 7/10
skill GitHub

ai-academic-workflow: 30 Step-Level Skills for the Full Academic Research Lifecycle

Thirty modular skills covering the full academic research workflow — topic selection, literature search and analysis, research design, data analysis, and full draft writing. Each skill can run independently or be composed into pipelines; works with Claude Code and Codex.

academicresearchskillsworkflow
by qiaomiaojoe Jul 17, 2026 5/10
skill GitHub

SKILLmama: Rank and Score the Best Library or SDK for Your Exact Stack

Five-tier search that finds, scores, and ranks the best library for your specific tech stack with deterministic scoring and a built-in security gate. No Reddit threads or outdated blogs — works with Claude Code, Claude.ai, Codex, and Antigravity.

skilllibrariesscoringdiscovery
by Magithar Jul 17, 2026 7/10
skill GitHub

clud-bug: Claude PR Review Bot That Cites Your Team's Markdown Standards

Encodes team standards (brand voice, API contracts, compliance, test discipline) as Markdown skills that the bot cites by name on every PR review. One-command setup via npx and project-aware without requiring a custom integration.

pr-reviewskillteamstandards
by thrillmade Jul 17, 2026 7/10
skill GitHub

obsidian-vault-skills: Author Claude Code Skills as Obsidian Notes, Export as Plugin

Write Claude Code skills and agents as notes in an Obsidian vault using Johnny Decimal organization, then export them to a native Claude Code plugin via an Obsidian plugin and MCP server combo. Brings all the linking and search of Obsidian to skill authoring.

obsidianskillpluginorganization
by nelsonlove Jul 17, 2026 8/10
skill GitHub

totem: Plain-File Rules, State, and Context for Any Coding Agent

Stores rules you can enforce, state you can derive, and context you can query as plain files in your repo — compatible with any coding agent. Agent-agnostic alternative to proprietary memory formats that works via standard file reads.

rulesstatecontextagent-agnostic
by mmnto-ai Jul 17, 2026 7/10
skill GitHub

handoff-skill: Project-Neutral Context Transfer Between AI Sessions

Portable skill for handing off working context between AI sessions with a strict single source of truth. Works across any project and any agent. Useful for maintaining continuity when hitting context limits or switching agents.

skillcontexthandoffsession
by uchimata2 Jul 17, 2026 7/10
skill GitHub

agent-skill-description-optimizer: Auto-Improve Claude Skill Trigger Descriptions

Optimizes the description frontmatter of Claude Code skills — the text Claude uses to decide whether to invoke the skill. Both evaluation and improvement run through the claude -p CLI so no API key is required. Helps skills fire reliably without manual tuning.

skilloptimizationdescriptionautomation
by netopsengineer Jul 17, 2026 8/10
skill Reddit

Overdrive: Open-Source Setup With 160 Skills, Skill Router, and Cross-Session State

Overdrive is a one-command installer that packages 160 curated skills (each pinned to a reviewed commit with licenses checked), a custom skill router that loads only what the current task needs, global instructions adapted from Karpathy's Claude prompt, and a .overdrive/ project state system that persists decisions and progress across sessions. Works with Claude Code, Codex, Gemini CLI, Cursor, and Antigravity.

skillssetupskill-routerstate-managementworkflow
by StefanDumitru Jul 16, 2026 8/10
skill GitHub

humanize-code: Strip AI-Tells From Code With 16 Research-Backed Pattern Detectors

A Claude Code skill that identifies and removes 16 specific patterns that mark code as AI-generated, making the output read as human-authored. Research-backed detection of AI coding tells, designed to be model-agnostic. Aimed at developers who need to blend AI-generated code into existing codebases without stylistic friction.

skillcode-styleai-detectionhumanize
by avi-dev-user Jul 16, 2026 6/10
skill Reddit

Think Before Code: 8-Skill Socratic DSA Tutor That Refuses to Solve for You

Think Before Code is a suite of 8 Claude Code skills turning the agent into a Socratic DSA tutor — one focused question at a time, graduated hints, required manual dry runs, and refusal to replace the learner's code during debugging. Covers problem decoding, dry runs, debugging, complexity analysis, test design, pattern transfer, and mock interviews. Drop a skill directory into Claude Code or paste the SKILL.md.

skillsdsatutoringlearningsocratic
by Agitated_Crew_368 Jul 16, 2026 7/10
skill GitHub

google-jules-skill: Control Google Jules Sessions via REST API From Coding Agents

A skill and CLI that lets LLM agents (Claude Code and others) manage Google Jules coding sessions via REST API — checking status, sending instructions, retrieving reports, merging results, and closing sessions. Useful for orchestrating Jules as a sub-agent in a larger multi-agent workflow from Claude Code.

skillgoogle-julesrest-apimulti-agentorchestration
by Laurenfeminine36 Jul 16, 2026 6/10
skill GitHub

legal-ops-germany: Claude Code Skills for German Law Firm Non-Billable Work

An experimental toolkit using Claude Code skills and deterministic Python executors to handle non-billable administrative work at German law firms — tasks that consume associate time without generating revenue. Demonstrates domain-specific Claude Code applications in a regulated professional context. Not intended for legal advice.

legalskillsgermanylaw-firm
by eliasreiche Jul 16, 2026 5/10
skill GitHub

product-playbook: 18-Command Guided Pipeline From Idea to Shipped Product

product-playbook is a principle-driven Claude Code skill set with 18 sequential commands covering each phase of product development, from initial spec through shipping. Evidence-based gates between phases prevent skipping steps or drifting off track. Designed to keep both the developer and the AI disciplined through the full build cycle.

skillsproductworkflowpipelinediscipline
by kish21 Jul 16, 2026 7/10
skill GitHub

trigger-flare: AI-Powered Signal Triage Skill for Claude Code

A Claude Code skill that acts as a signal radar, applying smart triage to prioritize and filter incoming signals. Useful for teams managing high-volume information streams that need intelligent routing before action. Targeted specifically at Claude Code workflows with AI-driven categorization.

signal-triageskillautomationfiltering
by Kaydevi Jul 16, 2026 5/10
skill Reddit

consolidate-permission-prompts: Clean Up Redundant Claude Code Allowlist Rules

A Claude Code skill that scans your permissions.allow list, identifies every rule already covered by a broader one, and removes the redundant entries without narrowing what is actually allowed. Addresses the common problem of allowlists growing to hundreds of dead rules over time — particularly WebFetch per-domain rules made pointless by a single wildcard. Pairs with the built-in /fewer-permission-prompts, which stops future bloat.

skillpermissionscleanupallowlistmaintenance
by Myth_Thrazz Jul 16, 2026 8/10
skill GitHub

blindfleck: Adversarial Review Skill for Offers, Pitches, and Strategy Docs

A Claude Code skill that simulates the toughest skeptical reader for business documents — offers, pitches, and strategy docs. It maintains a memory of where your writing has historically been weak and targets those areas first in each review. Produces critical, adversarial feedback rather than encouraging polish.

skillwritingadversarialdocument-reviewstrategypitches
by FermainPariz Jul 16, 2026 6/10
skill GitHub

claude-config: Centralized Memory, Skills, and Agents with One-Command Install

A Claude configuration framework that centralizes memory files, skills, and agent definitions in a single versioned repository with a one-command installer. Lets you maintain a personal or team Claude setup that can be reproduced on any machine in seconds. Covers CLAUDE.md, skill files, and agent prompts in a structured layout.

configskillsmemoryagentsversionedinstall
by RemiAsselin42 Jul 16, 2026 6/10
skill Reddit

Closeout Skill: Session Audit with Claim Verification and Cold Review Agent

A Claude Code skill that runs at the end of each session: verifies all factual claims made during the session, greps for loose ends in the written code, produces a handoff.md, and then spawns a cold review agent to audit all of it independently. Designed to catch the common pattern of an agent hallucinating success — including catching a prior Opus session going off-rails.

skillsession-auditclaim-verificationhandoffquality-controlreview
by Mammoth_Pain2075 Jul 16, 2026 7/10
skill Reddit

react-native-boost: Claude Code Skill Covering Real App Store and EAS Build Gaps

A Claude Code skill filling what agents typically miss in React Native: exact App Store Connect and Google Play field character limits, correct EAS Build profiles, iOS vs Android permission configs side by side, and fixes for 8 common terminal errors. Works with Claude Code, Cursor, and Windsurf.

react-nativeskillsapp-storeeas-buildiosandroid
by Direct-Attention8597 Jul 16, 2026 8/10
skill Reddit

Anti-Sycophancy Skill: Makes Claude Argue Against You Before Answering

A free skill that forces Claude Code to try to prove you wrong before it gives you an answer. Counters the "you're absolutely right!" problem where Claude agrees too readily, turning 3-hour decision debates into minutes.

sycophancyskillscritical-thinkingreasoning
by AccomplishedCut6374 Jul 16, 2026 7/10
skill Reddit

Drive a macOS Desktop From a Linux AI Agent Over SSH Using Tart VMs

A write-up and skill set for connecting a Linux AI agent to a macOS machine via SSH to boot Tart VMs, take screenshots, click, type, and record video — enabling macOS-specific testing (Gatekeeper, TCC prompts) from a Linux agent. Uses a one-seam CLI design with stdout for data and stderr for logs.

macosvmtartsshskillstestinglinux
by jonnyzzz Jul 16, 2026 7/10
skill GitHub

ruleferry: Audit and Sync Coding-Agent Instruction Files Across Tools

Safely audits and synchronizes coding-agent instruction files (CLAUDE.md, AGENTS.md, .cursorrules, etc.) across Codex, Claude Code, Cursor, Copilot, Gemini CLI, and OpenCode. Keeps your rules consistent when using multiple coding agents on the same project.

AGENTS.mdCLAUDE.mdsyncrulesmulti-tool
by starinzlob Jul 16, 2026 7/10
skill GitHub

e5-real-skills: B2B Marketing Claude Skills From Exit Five Podcast

A living library of B2B marketing Claude skill files built from expert insights on the Exit Five podcast. Auto-updates with new episodes — practical marketing skills sourced directly from practitioner-level discussions.

marketingb2bskillspodcastauto-update
by the-nam-shub Jul 16, 2026 5/10
skill GitHub

agent-os: Lifecycle-First OS for AI-Assisted Engineering and Research

A lifecycle-first operating system for AI-assisted engineering, architecture, research, UX, infrastructure, and decision-making. Provides a unified framework for managing the full agent-assisted software development lifecycle.

operating-systemlifecycleengineeringresearchskills
by ignazio-ingenito Jul 16, 2026 7/10
skill GitHub

secure-code-auditor: Backend Security Audit Agent Skill With Deep Django Coverage

A backend security Agent Skill that helps AI audit code for vulnerabilities and generate secure-by-default backend applications. Provides deep Django/DRF coverage and guidance for other backend stacks — covers OWASP and common injection patterns.

securityauditdjangobackendskillsowasp
by n-shadloo Jul 16, 2026 7/10
skill GitHub

ai-tools-cheatsheets: Open-Source Handbook for AI Coding Tools and MCP Servers

A comprehensive open-source handbook covering AI coding tools, coding agents, MCP servers, AGENTS.md, prompts, engineering workflows, security, and team adoption. A reference resource for teams adopting AI-assisted development.

referencemcpAGENTS.mdsecurityteamhandbook
by AnkitParekh007 Jul 16, 2026 7/10
skill GitHub

skillwarden: npm audit for Agent Skills — Pin, Verify, and Audit-Gate

Like npm audit but for agent skills: pins skills to verified versions, verifies integrity, and gates execution through audit checks. Prevents unreviewed or tampered skills from running in your Claude Code sessions.

securityauditskillspinningintegrity
by FirstCastSolutions423 Jul 16, 2026 7/10
skill GitHub

balloontopic: Persistent Context Manager for Multi-Feature AI Development

A persistent context manager for multi-feature development with AI coding agents (Cursor, Claude Code, Codex). Maintains structured context across sessions so agents stay oriented on the right feature when context switches.

contextpersistencemulti-featureclaude-codeskills
by radhakishan404 Jul 16, 2026 6/10
skill GitHub

agentcairn: Long-Term Cross-Project Memory Using Your Obsidian Vault

Provides long-term, cross-project memory for AI coding agents using your Obsidian vault as the source of truth. Daemonless, no opaque databases — your memory files are plain Markdown you own and can edit directly.

memoryobsidiancross-projectlong-termlocal-first
by ccf Jul 16, 2026 8/10
skill GitHub

inverter: Turn Short Prompts Into Principal-Level Engineering Directives

Inverts short, unpolished prompts into Principal-level engineering directives aligned to the right discipline, then executes them. Built for vibe coders and lazy prompters who want better output without writing detailed prompts themselves.

promptsskillsengineeringclaude-codecodex
by Wishmeh Jul 16, 2026 7/10
skill GitHub

target-prioritization: Drug-Target Due Diligence Multi-Source Skill

A multi-source drug-target due diligence pipeline for biomedical research: takes a ranked gene list and generates per-gene dossiers across UniProt, OpenTargets, and PubMed with cross-lineage DE scanning and composite re-ranking. A Claude Code/OpenClaw/SkillsMP skill.

biomedicalresearchskillsdrug-discoverymcp
by Agents365-ai Jul 16, 2026 5/10
skill GitHub

ariadne: Agent Skills for Scope-Safe Markdown Knowledge Vaults

Open-source agent skills for building Markdown knowledge vaults with deterministic validation and research workflows. Keeps knowledge bases scope-safe and structured for AI agent use.

knowledge-basemarkdownvaultskillsresearch
by pariyar07 Jul 16, 2026 6/10
skill GitHub

prefix-first-design: Session Framework for AI-Assisted Design Decisions

A structured session framework for AI-assisted design: casts a stable brief first, then explores against it, and ships decisions alongside the work with a check that the original brief still holds. Prevents design drift during long agent sessions.

designframeworkskillsbriefsessions
by iruhdam1 Jul 16, 2026 5/10
skill GitHub

agent-harness: 14 Risk-Gated Claude Code Skills for Full Delivery Lifecycle

Fourteen invocable skills that carry a change from brainstorm through shipping, with an embedded harness deciding how careful to be at every step based on risk assessment. Provides a structured, risk-aware workflow for feature delivery.

skillsrisk-gatesdeliveryworkflowclaude-code
by minhtran3124 Jul 16, 2026 7/10
skill GitHub

textbook-writer-skills: UbD Reverse-Design Textbook Writing for AI Agents

A skill suite for writing STEM textbooks using Understanding by Design (UbD) reverse-design methodology. Guides agents through teaching positioning, chapter tree gating, chapter-by-chapter writing, and verified example calculation — with interrupt-and-resume support.

educationtextbookskillsstemwriting
by cabbage2000-lab Jul 16, 2026 5/10
skill GitHub

styleseed: Design Engine for Claude Code With 74 Rules and 7 Brand Skins

Teaches design judgment to Claude Code, Codex, and Cursor — not just data. Includes 74 rules, 48 components, 7 brand skins (Toss/Stripe/Linear/Notion/Raycast/Arc/Vercel), a named motion system, and 15 /ss-* skills to stop shipping AI-generated-looking UI.

designuiskillsbrandcssfrontend
by bitjaru Jul 16, 2026 8/10
skill GitHub

ai-app-cloner: Clone a Mobile App Into Expo/React Native From Screenshots

An open-source Claude Code skill that takes screenshots of an existing mobile app and generates a working Expo/React Native project from them. Useful for rapid prototyping and learning from existing UI patterns.

mobilereact-nativeexposkillsclone
by Birkenpapier Jul 16, 2026 7/10
skill Reddit

Lessons Learned Running Claude Code Loops: Docs, Skills, Hooks, and DAGs

A practitioner shares key insights from extended Claude Code use: always document before running loops, use DAGs for structured task flows, build custom hooks for prompt validation and memory injection, and treat prompt engineering as a multi-hour collaborative project. Includes specific skill examples for session behavior.

best-practicesloopsskillshooksdags
by Competitive-Net-5306 Jul 16, 2026 7/10
skill Reddit

Skill Ordering and Priority Conflicts in Stacked Claude Code Skills

Discussion of how Claude Code handles skills that conflict on ordering — specifically when two skills both want to run "first." Raises the question of priority resolution and unpredictable behavior when multiple skills install competing step-zero instructions.

skillsorderingconflictsbest-practices
by NoBarber4287 Jul 16, 2026 5/10
skill Reddit

Claude Code as Solo Founder Project Manager: Kanban Skill With Memory

A kanban skill for Claude Code that converts rough goals into structured tasks, does keyword research for content, learns from feedback via auto-pruning memory, and generates daily prioritization reports. Built for solo founders managing product, marketing, and engineering in one agent loop.

kanbanskillsmemoryproductivitysolo-founder
by void_tao Jul 16, 2026 7/10
skill GitHub

research-cards: Teaching-Style Research Automation for Claude Code

Automates research card creation in the style of Hung-yi Lee — supports plain Markdown, Obsidian, and Heptabase backends with bidirectional sync. Driveable by Claude Code or Codex for systematic academic and technical research workflows.

researchobsidianskillsknowledge-management
by SungFeng-Huang Jul 16, 2026 7/10
skill GitHub

market-intel: Claude Code Skill for Commercial and Market Research

A thin Claude Code skill that triages 15 specialized data domains and auto-configures the right MCP sources for market intelligence. Includes a deterministic refresh pipeline with adversarial verification, companion-config auto-registration, and citation guardrails.

market-researchskillsmcpdata
by DaizeDong Jul 16, 2026 7/10
skill GitHub

skillstead: Practical Portable Skills for Agentic Coding Workflows

A curated collection of practical, portable skills designed for agentic coding workflows. Focused on real-world utility that transfers across different projects and coding agent environments.

skillsportablecoding-workflows
by kyungseo Jul 16, 2026 6/10
skill GitHub

jaimitos-claude-setup: Lean Project-Neutral OS for Claude Code

A lean, project-neutral operating system for Claude Code featuring auto-maintained docs, deterministic hooks, an independent evaluator, watchable and headless autopilots, and portable skills. Designed for solo engineers who want a structured, reusable Claude Code baseline.

claude-codesetuphooksskillsautopilot
by jaimeberdejo Jul 16, 2026 8/10
skill GitHub

tradeos-marketplace: AI-Strategist to Live-Trading Plugin for Claude Code

A Claude Code plugin that connects AI strategy generation to backtesting and live trading. Enables coding agents to participate in the full trading development loop — from strategy ideation through execution.

tradingskillsbacktestingfinance
by multiwave-co-ltd Jul 16, 2026 6/10
skill GitHub

agent-skills (itsgitz): Personal Claude Code Skill Collection

A personal skill collection compatible with any AI agent that supports ~/.agents skills, including Claude Code, Cursor, and OpenCode. Covers common coding, automation, and workflow tasks.

skillsportableclaude-codecursor
by itsgitz Jul 16, 2026 5/10
skill GitHub

agent-foundation: Claude Code Skills Marketplace for Backend and Frontend

A skills marketplace with backend and frontend engineering conventions plus step-by-step integration recipes for Stripe, Singpass/Keycloak OIDC, Twilio SMS, Docker, and CI/CD. Covers NestJS/TypeScript and React in a language-flexible format.

skillsbackendfrontendintegrationsnestjsstripe
by kennguyen887 Jul 16, 2026 7/10
skill GitHub

presentation-skill-pack: Turn Notes into Slide Decks via Claude Code

A skill + MCP server that converts rough notes into schema-validated slide decks and exports native PowerPoint, Keynote, and Google Slides. Works with Claude Code, Cursor, Codex, Gemini CLI, and Copilot — letting any AI agent produce presentation-ready output.

skillmcppresentationspowerpointkeynotegoogle-slides
by isatimur Jul 16, 2026 7/10
skill GitHub

trackbed: Skills-Only Roadmap and Orchestration Layer for Claude Code

trackbed provides roadmap, status, and orchestration as pure agent skills — no framework required. Works with Claude Code, OpenCode, and GitHub Copilot CLI. Keeps the project management rails lightweight and portable across AI coding tools.

skillsroadmaporchestrationproject-management
by Orfi Jul 16, 2026 6/10
skill GitHub

generate-wiki: Agent Skill That Builds a PR-Traceable Architecture Wiki

An agent skill that generates and refreshes an internal architecture wiki with decisions anchored to source files and PRs. Works with Claude Code and any agent supporting the Agent Skills format. Keeps documentation in sync as the codebase evolves.

skillwikidocumentationarchitecturepr-tracking
by sirius-zuo Jul 16, 2026 7/10
skill GitHub

ai-research-writing-skill: Agent Skill for ML Paper Writing from Code and Experiments

An agent skill for ML/AI/CV/NLP researchers: point your coding agent at code, experiment logs, and a venue template to produce an evidence-backed LaTeX draft and submission package. Focused on auditable, evidence-backed output rather than generated fiction. Works with Claude Code and compatible agents.

skillresearchlatexmlacademic-writingpaper
by jin-s13 Jul 16, 2026 7/10
skill GitHub

agentic-flake: Composable Agent Skills and Nix Environments

Composable agent skills paired with project-scoped Nix environments. Provides reproducible, hermetic dev environments alongside agent skills — useful for teams that use Nix and want both reliable toolchains and agent workflow conventions in one package.

skillnixenvironmentsreproduciblecomposable
by 0xc000022070 Jul 16, 2026 7/10
skill GitHub

Server-Side Swift Skills and Xcode Cloud Knowledge Files for Claude Code

Curated knowledge files that accelerate server-side Swift development and Xcode Cloud automation when used with Claude Code. Brings Claude Code up to speed on Vapor, SwiftNIO, and Xcode Cloud conventions without repeated context-setting.

skillswiftserver-side-swiftxcode-cloudvaporknowledge-files
by Insolvent-pyrene754 Jul 16, 2026 6/10
skill GitHub

hermes-CCC: Hermes Agent Skills Natively Inside Claude Code

Integrates Hermes Agent skills directly into Claude Code for in-process agentic operations — no external process spawning or file locking. Lets Claude Code use Hermes-format skills as native first-class capabilities.

skillhermesintegrationagenticin-process
by Arseni6361 Jul 16, 2026 7/10
skill GitHub

slowmist-security-cc: Security Audit Framework for Claude Code Agents

A skill-based security framework for auditing Claude Code agents in adversarial environments. Detects vulnerabilities, social engineering attempts, and supply chain threats in agent sessions — based on SlowMist's security research methodology.

securityauditskilladversarialsupply-chainslowmist
by Leontynestirredup43 Jul 16, 2026 7/10
skill GitHub

zenodo-skill: Manage Research Artifacts and DOIs from Claude Code

A skill for managing Zenodo research artifacts directly from Claude Code or OpenClaw: automate deposits, generate citable DOIs, and manage research data releases through the Zenodo REST API.

skillzenodoresearchdoiacademicapi
by Georgiannebedded725 Jul 16, 2026 6/10
skill GitHub

hikizan: Verb-Split Claude Code Skills for Design, Review, TDD, and PR Flow

A Claude Code plugin and Agent Skills pack that separates concerns by verb: distinct skills for design, review, TDD, and PR flow. Backed by deterministic git hooks as safety floors — so conventions are enforced even if the agent skips reading the skill.

skilltddcode-reviewgit-hookspr-flowdesign
by hayashiii-ghub Jul 16, 2026 8/10
skill GitHub

sheet-happens: Claude Skill for Auditing Inherited Excel Models

A Claude skill that maps inherited Excel models into an interactive HTML showing how every sheet, block, and line item connects — plus an audit of hardcodes, error cells, and circular references. Invoke with /sheet-happens in any chat, or ask naturally. Runs fully locally.

skillexcelauditspreadsheethtmlreverse-engineering
by Felixx1502 Jul 16, 2026 7/10
skill GitHub

Backblaze B2 Cloud Storage Skill for Claude Code

An official Backblaze skill for managing B2 cloud storage from the terminal using natural language. Covers bucket management, file listing and search, storage auditing, security posture review, and safe cleanup of stale or large objects. Built on the Agent Skills specification and compatible with Claude Code.

skillcloud-storagebackblazeb2devops
by backblaze-labs Jul 16, 2026 7/10
skill GitHub

OneWave claude-skills: 172 Production-Ready Skills for Sales, Marketing & Engineering

A curated set of 172 production-ready Claude Code skills from OneWave AI spanning sales, marketing, design, engineering, and AI agent architecture. Skills are maintained as a living collection, making it a broad starter toolkit for teams wanting coverage across business and technical workflows.

skillcollectionsalesmarketingengineeringagent-architecture
by OneWave-AI Jul 16, 2026 6/10
skill GitHub

slop-cop: Audit, Grade, and Rewrite AI Slop Across Prose, UI, and Code

slop-cop is a Claude Code skill that detects and rewrites generic AI patterns across multiple content types: prose, social posts, UI/design, and code. It grades drafts for slop markers (vague claims, repetitive rhetoric, happy-path-only logic) and rewrites them with specificity. Useful for de-slopping any AI-generated output before publishing.

skillcontent-qualityai-slopwritingcode-review
by howshannon Jul 16, 2026 6/10
skill GitHub

agbox: Promote Repeated Agent Corrections into Reusable CLAUDE.md Skills

agbox is a local CLI that captures instructions you repeatedly give to AI agents (Claude Code, Codex, Cursor) and promotes them into AGENTS.md or CLAUDE.md memory files that agents actually follow. Reduces the "why won't it remember this?" friction by automating the capture-and-codify loop. Vendor-neutral, private, and reversible.

skillmemoryclaude-mdproductivityagent-memory
by qyinm Jul 16, 2026 8/10
skill GitHub

grok-skills: Use Grok from Claude Code for Review, Reasoning, and Implementation

grok-skills lets Claude Code delegate tasks (review, reason, implement, verify) to xAI's Grok model via a sandboxed companion. Supports both hardened and direct modes. Useful for getting a second-opinion from a different model family without leaving your Claude Code workflow. Not affiliated with xAI.

skillgrokmulti-modelcode-reviewreasoning
by sfourdrinier Jul 16, 2026 6/10
skill GitHub

reflect: Decision Framework Skill Using Bezos, Munger & Farnam Street Models

reflect is a Claude Code skill that runs your decisions through 23 compacted mental models drawn from Jeff Bezos, Charlie Munger, and the Farnam Street framework. It gives an opinionated call with reasoning and keeps a score of your predictions. Useful for high-stakes product, architectural, or strategic decisions.

skilldecision-makingmental-modelsproductivity
by seldonframe Jul 16, 2026 5/10
skill GitHub

tax-sarathi: Claude Code Skill for Indian Income Tax Filing with Live Portal Verification

tax-sarathi is a Claude Code skill for Indian income tax and ITR filing covering FY2025-26, with calculators for tax liability and live read-only verification against the e-filing portal via Playwright over CDP. The agent guides but does not submit — you retain control. Useful for Indian developers managing their own tax filings.

skilltaxindiaitrplaywrightcdp
by kumarrahul85 Jul 16, 2026 6/10
skill GitHub

Claude Code + Codex Infrastructure for PhD Researchers

A shareable Claude Code and Codex skill/agent infrastructure tailored for academic workflows. Includes skills, agents, hooks, and rules designed specifically for PhD research tasks. Targets the academic use case that generic setups often miss.

academicresearchPhDcodexskills
by flonat Jul 15, 2026 6/10
skill GitHub

tartinerlabs/skills: Claude Code Skills for Git, GitHub, Security, and Refactoring

A curated set of Claude Code skills covering git workflows, GitHub automation, security audits, code refactoring, and general project tooling. Each skill is ready to drop in and handles common developer tasks that benefit from repeatable AI-driven workflows.

gitgithubsecurityrefactoringautomationskills
by tartinerlabs Jul 15, 2026 7/10
skill GitHub

AER-Skills: Agent Skills for Academic Economics Paper Publishing

A stack of Claude Code skills targeting academic economists aiming to publish in top journals like AER and AEJ. Skills cover identification-first empirics, AEA-compliant replication packages, Keith Head–style introductions, and R&R rebuttals. Covers the full pipeline from topic selection to submission.

academiceconomicsresearchempiricsskills
by brycewang-stanford Jul 15, 2026 6/10
skill Reddit

Claude Code Skills for Operating Real-Time Data Pipelines (Estuary)

Estuary built Claude Code agent skills for interacting with real-time data pipelines — configuring sources and destinations, creating pipeline specs, checking task health, pulling logs, and investigating failures. The skills keep pipeline configuration visible to the operator throughout. Demo covers both what Claude handles well and where human guidance is still needed.

data-pipelinesreal-timeestuarydevopsskills
by dani_estuary Jul 15, 2026 6/10
skill GitHub

long-video-to-shorts: Local Opus Clip Alternative as a Claude Code Skill

A Claude Code skill that converts long videos into vertical 9:16 captioned short clips entirely locally — no cloud service required. Functions as a self-hosted alternative to Opus Clip. Handles cropping, captioning, and output formatting as a repeatable AI-driven workflow.

videoshort-formlocalskillcontent-creation
by joe-jns Jul 15, 2026 6/10
skill GitHub

desrobotizar: Remove Spanish AI Slop from LLM Output

A Claude skill that detects and removes robotic AI writing patterns from Spanish-language LLM output, learning the user's personal writing style over time. Addresses the common problem of LLM text sounding unnatural in Spanish. Useful for Spanish-speaking writers using Claude for content creation.

spanishwritingstyleslop-removalskill
by mszsorondo Jul 15, 2026 5/10
skill GitHub

pr-review-skill-generator: Mine Merged PRs to Generate a Repo-Specific Code Reviewer

A meta-skill that analyzes a repository's merged pull request history to generate a custom Claude Code skill tuned to that codebase's specific patterns, business logic, and conventions. The generated reviewer knows what matters in your project specifically, not just generic best practices. Clever self-bootstrapping approach to personalized AI code review.

code-reviewprmeta-skillskill-generationcodebase-aware
by paanSinghCoder Jul 15, 2026 8/10
skill GitHub

handle-with-adhd: Claude Code Skill for Adult ADHD Users

A Claude Code skill built from real use by an adult ADHD user, focused on zero-friction task execution and continuous memory capture. Avoids hidden costs and interruptions that disrupt focus, capturing context automatically so nothing is lost between sessions. Designed from lived experience rather than theory.

adhdaccessibilitymemoryfocusproductivityskill
by lubianiec Jul 15, 2026 6/10
skill GitHub

agent-skills: Disciplined AI Skills With Pre-Declared Kill Criteria and Usage Metrics

A collection of small, focused AI agent capabilities where each skill ships with a pre-declared kill criterion (when to retire it) and real usage numbers. Takes a disciplined, data-driven approach to skill management rather than accumulating skills indefinitely. Useful as a template for teams wanting to maintain skill hygiene.

skillsmetricslifecycledisciplineagent-skills
by AdityaVasireddy Jul 15, 2026 6/10
skill Reddit

Lemma: Claude Code Plugin for Rigorous Data Science Workflows

Lemma is a Claude Code plugin that adds methodological rigor to data science work via a structured persona, task-specific skills (EDA, causal inference, etc.), and live notebook kernel access. Benchmarked against DSAEval, the base agent gave confidently wrong answers in 3/5 hard cases while Lemma reduced that to roughly 1 in 7. A well-validated approach to making Claude Code a more careful analysis partner.

data-scienceskillpluginbenchmarknotebookCLAUDE.md
by Spare_Suit3701 Jul 15, 2026 8/10
skill GitHub

writers-room: Local-First Editorial Studio Claude Code Plugin

A Claude Code plugin (also Codex-portable) that turns Claude into a personal editorial studio with a filesystem-based content board. Its voice memory learns from your own edits rather than relying on humanizer tools, so your distinctive style is preserved across AI-assisted writing sessions. Designed for writers who want consistent voice without cloud dependencies.

writingeditorialpluginvoice-memorylocal-firstCLAUDE.md
by dhalarewich Jul 15, 2026 6/10
skill GitHub

skillZs: Open Hub for Discovering and Installing SKILL.md Workflows

An open directory for discovering, comparing, creating, and safely installing SKILL.md workflows for Claude Code agents. Provides a curated hub with a safety-focused installation flow to vet community skills before adding them to your setup. Fills a real gap in the Claude Code ecosystem for skill discoverability and distribution.

skillsSKILL.mddirectorydiscoverycommunityworkflowsinstallation
by CarlosJunioor Jul 15, 2026 8/10
skill GitHub

IFRS Skill: Accounting Standards Guidance for AI Agents

A Claude Code skill providing IFRS (International Financial Reporting Standards) guidance with cited answers and audit support. Gives AI agents the ability to answer accounting standard questions and verify compliance against up-to-date IFRS requirements. Targeted at finance and accounting teams using Claude Code.

ifrsaccountingfinancecomplianceaudit
by babu9893 Jul 15, 2026 5/10
skill Reddit

PitsiUI: Free Open-Source Cross-Platform UI Component Library for Claude Code

A polished, free, open-source component and blocks library (shadcn registry compatible) designed to help Claude produce Apple-quality UI. Includes real app templates, composed components, tested UX flows, and full logic — not just generic dashboard widgets. Comes with Claude Code skills and instructions to guide it toward professional design output.

uicomponentsshadcndesignfrontendopen-source
by Admirable-Canary-732 Jul 15, 2026 7/10
skill GitHub

claude-for-datascience: Opinionated Claude Code Scaffold for Computer Vision and ML

An opinionated Claude Code scaffold tailored for computer vision and data science projects, bundling skills, subagents, and enforcement hooks. Bakes in reproducibility practices and prevents evaluation set leakage by design. A strong starting point for ML practitioners who want Claude Code aligned with data science best practices.

data-sciencemachine-learningcomputer-visionreproducibilityscaffold
by BrendenKennedy Jul 15, 2026 7/10
skill GitHub

de-slop: Claude Code Skill to Remove AI Slop from Prose

A portable Claude Code skill that detects and rewrites "sloppy" AI-generated prose into content with a real point of view. Uses a fidelity-first approach — it flags hollow spans and rewrites them with scored self-evaluation and iteration. Great for teams publishing content written or assisted by AI who want to avoid generic output.

writingproseai-slopcontent-qualityediting
by isatimur Jul 15, 2026 7/10
skill GitHub

Claude Skill Doctor: Audit and Score Your SKILL.md Files

A meta-skill (zero dependencies) that inspects SKILL.md files and scores them across six dimensions: trigger quality, length, progressive disclosure, script externalization, portability, and security (no hardcoded secrets). Outputs a scored report with fix suggestions. A sister tool to claude-md-doctor, useful for anyone building and maintaining a library of Claude Code skills.

skill-qualitylintingmeta-toolauditskill-md
by huiyonghkw Jul 15, 2026 6/10
skill GitHub

DesignThinking Skill: Full Empathize-to-Assess Pipeline via Chained Subagents

A Claude Code skill that runs a complete Design Thinking pipeline — Empathize, Define, Ideate, Prototype, Test, and Assess — as a sequence of chained subagents. Takes a SMART goal as input and produces a VIP business assessment. Useful for product and strategy work that benefits from a structured ideation process.

design-thinkingproductstrategysubagentsideation
by hyunbean Jul 15, 2026 6/10
skill GitHub

repo_worklog_skill: Auto-Generate Daily Work Logs from Real Git Diffs

A Claude Code agent skill that reads actual Git diffs (not just commit messages) and generates a per-day project worklog under PROJECT_WORKLOG/ with an index file. Previews every change before writing and creates one Markdown file per day. Useful for developers who need to produce accurate time-stamped activity reports from code history.

gitworklogdocumentationreportingproductivity
by g761007 Jul 15, 2026 7/10
skill GitHub

design-artifact: Skill to Build Polished Interactive HTML Artifacts

An awesome-skills skill for building and verifying polished interactive HTML artifacts and responsive prototypes. Handles the full cycle of generation and visual verification. Useful for quickly producing UI demos, design handoffs, or interactive specs without leaving Claude Code.

htmlprototypedesignartifactui
by awesome-skills Jul 15, 2026 7/10
skill GitHub

create-html-deck: Skill to Build Browser-Native HTML Presentations

An awesome-skills skill that builds and verifies browser-native HTML presentations optimized for laptops and projectors. Generates complete slide decks without external dependencies. A quick way to produce shareable presentations directly from Claude Code.

htmlpresentationslidesprototype
by awesome-skills Jul 15, 2026 6/10
skill GitHub

Python Code Review Skills for Agentskills.io Agents

Portable Python code-review skills covering type safety, error handling, anti-patterns, async usage, and code style. A router skill dispatches to the most relevant focused reviewer for each concern.

pythoncode-reviewtype-safetyasyncanti-patterns
by CodeSigils Jul 15, 2026 6/10
skill GitHub

Custom Claude Code Config as Disciplined Engineering Partner

A custom Claude Code configuration that transforms the agent into a disciplined engineering partner with structured workflows, strict guardrails, and domain-specific expertise baked into the setup.

configurationclaude.mdguardrailsengineeringworkflows
by domengabrovsek Jul 15, 2026 6/10
skill GitHub

Web Performance Audit Skill with Multi-Agent Pipeline

Audits web performance using a multi-agent pipeline that turns browser data into actionable fixes for Core Web Vitals and related metrics. Structures the audit as parallel agent passes over different performance dimensions.

web-performancecore-web-vitalsmulti-agentauditingoptimization
by sa746062 Jul 15, 2026 6/10
skill Reddit

Shopping Lookbook Skill: Build Shoppable Sites with Claude Code

A generic Claude Code skill for building shoppable lookbook sites hosted on GitHub Pages. Demonstrated by finding large-size hats — shows how to connect product search requirements to a published, browsable site.

ecommercelookbookshoppingskillgithub-pages
by DrewHoov Jul 15, 2026 5/10
skill GitHub

Agentic-Kits: Reusable DevOps AI Skill Kits

Reusable AI skill kits covering Docker, Kubernetes, Zabbix, ELK, and Grafana infrastructure — with skills, rules, and templates for coding agents. Includes .NET 10 examples.

devopsdockerkubernetesinfrastructureskills
by KhaiTrang1995 Jul 15, 2026 6/10
skill GitHub

Agent-Knowledge: Portable Knowledge Base as Open Knowledge Format

The kb-* agent skill family for building and maintaining a portable knowledge base as an Open Knowledge Format (OKF) bundle, enabling persistent, structured project knowledge that travels with agents.

knowledge-baseokfportablememorydocumentation
by stjbrown Jul 15, 2026 6/10
skill GitHub

Research-Anything: All-Channel Research Skill for Claude Code

Sweeps Douyin, Xiaohongshu, Zhihu, Bilibili, YouTube, GitHub, X, and the web for first-hand practices, verifies claims with sub-agents, and converges on one actionable plan from a single research prompt.

researchmulti-channelsubagentsverificationactionable
by Somezak1 Jul 15, 2026 6/10
skill GitHub

Claude Toolbox: Small Install-and-Own Claude Code Skills

An open library of small, install-and-own Claude Code skills including a wording linter and a pre-public secret scanner to catch exposed credentials before pushing. Each skill is self-contained and ownership-friendly.

skillslintingsecuritysecret-scanningutilities
by JayOfemi Jul 15, 2026 6/10
skill GitHub

13 Claude Skills for Learning and Teaching

A skill set for education: flashcard generation, concept explanation, study plans, exam prep, and research summaries. Covers both the learner and teacher roles with separate skill entries for each.

educationflashcardsteachinglearningstudy-plans
by prvthmpcypher Jul 15, 2026 5/10
skill GitHub

26 Claude Skills for Designers

A collection of 26 Claude skills covering UI/UX, brand identity, typography, frontend design, accessibility, and visual storytelling — a broad toolkit for design-focused Claude Code workflows.

designui-uxbrandingtypographyaccessibility
by prvthmpcypher Jul 15, 2026 6/10
skill GitHub

Acceptance-Driven Development Skill for AI Coding Agents

Enforces acceptance-criteria-driven development for AI agents: done is a checklist, not a feeling. Keeps agents honest about completion by requiring machine-verifiable acceptance criteria before signoff.

acceptance-testingquality-gatestddverificationdone-criteria
by ZeusYue Jul 15, 2026 6/10
skill GitHub

Fact-Verify: Source Verification Skill for AI Research Results

Verifies AI research citations before trusting them: 4-tier source classification, re-citation chain detection, and URL/DOI/NTIS existence checking. Guards against hallucinated or misattributed sources.

fact-checkingresearchverificationcitationsquality-control
by parkjui92-tech Jul 15, 2026 6/10
skill GitHub

Display Design Studio: Curated AI Agent Skill Collection

A curated skill collection for AI agents including first-party skills and vendored framework/CMS best practices for use with the Agent Skills ecosystem and skills.sh.

skills-collectioncmsframeworksbest-practicesagent-skills
by display-design-studio Jul 15, 2026 6/10
skill GitHub

Economics Slides Skill: LaTeX/Beamer Presentations via Claude Code

An agent skill for producing professional academic economics slides in LaTeX/Beamer — handles paper-to-talk conversion, discussant decks, verified layouts, and accurate numbers. Designed for academic rigor.

latexbeamereconomicsacademicpresentations
by hanlulong Jul 15, 2026 5/10
skill GitHub

Soia Open Skills: Archive X Tweets and Telegram Messages to Obsidian

Agent skills for daily knowledge management: archive X tweets, threads, and articles into an Obsidian vault, with Telegram Saved Messages sync. Works with Claude Code, Codex, and Cursor.

obsidianknowledge-managementtwittertelegramarchiving
by soia-team Jul 15, 2026 6/10
skill GitHub

Threads Marketing Skills for Claude Code

Agent skills for marketing on Threads: write posts, multi-post threads, hooks, replies, and weekly content plans in your voice. Publish via Publora. Open source, MIT.

marketingsocial-mediathreadscontentpublishing
by sergebulaev Jul 15, 2026 5/10
skill GitHub

TikTok Marketing Skills for Claude Code

Agent skills for TikTok content creation: 3-second video hooks, captions, trend mapping, and weekly content plans. Draft, humanize, and publish via Publora. MIT licensed.

marketingtiktokvideocontentsocial-media
by sergebulaev Jul 15, 2026 5/10
skill GitHub

Animated Sketch Diagram Skill: Hand-Drawn Architecture Diagrams

A Claude Code skill that creates hand-drawn animated architecture diagrams — ink-on-beige-paper style with flowing dots. Exports as a self-contained HTML file or seamless-loop GIF.

diagramsanimationarchitecturehtmlvisualization
by OLDyade Jul 15, 2026 6/10
skill GitHub

Humanizer Workbench: Rewrite AI Text into Natural Writing

A CLI and Claude Code skill that spots AI writing patterns, refines tone, and improves rhythm to rewrite AI-generated text into natural-sounding prose you can publish without detection.

writinghumanizationai-textclitone
by aprempeh-tech Jul 15, 2026 5/10
skill GitHub

C# Brain for Claude: Curated .NET Knowledge Base

A curated C# and .NET knowledge base that powers Claude with better code patterns and architecture decisions for .NET projects — injected as project context for consistently idiomatic outputs.

csharpdotnetknowledge-basepatternsarchitecture
by Myosinstringer459 Jul 15, 2026 5/10
skill GitHub

Code-Humanizer: Remove AI Code Slop with Test-Gated Refactoring

A test-gated, behavior-preserving agent skill that removes AI-generated code patterns: duplicated helpers, try-import fallbacks, broad excepts, and speculative abstractions. Only ships changes where tests still pass.

code-qualityrefactoringai-sloptest-gatedcleanup
by LeonardNJU Jul 15, 2026 7/10
skill GitHub

Python Project Workflow Skill for Agentskills.io Agents

A portable Python project workflow skill covering greenfield bootstrap, tooling configuration, CI, packaging, mature-repo preservation, and cross-platform verification for agentskills.io-compatible agents.

pythonproject-setupcipackagingworkflow
by CodeSigils Jul 15, 2026 7/10
skill GitHub

Claude-Obsidian-Sessions: Compress and Resume Sessions in Obsidian

Adds /obsidian:compress to save the current Claude Code session as a structured log in Obsidian, and /obsidian:resume to reload project context from those logs. Bridges session memory with a personal knowledge base.

obsidiansession-managementmemorypluginsknowledge-base
by ERuban Jul 15, 2026 7/10
skill GitHub

Supergoal-Skill: Gated Dev Process with Expert Subagents

A Claude Code skill that takes one objective and runs a full gated development process using expert subagents, refusing to declare done until a machine-checkable gate passes. Bilingual (English/Korean) onboarding and live walkthrough included.

subagentsquality-gatestddworkflowverification
by cskwork Jul 15, 2026 7/10
skill GitHub

Tribunal: Independent QA for AI-Written Code Using Multiple Models

A Claude Code skill plus runbooks that put other coding models (Grok, Codex, local) on the review panel to provide independent QA for AI-written code. Cross-model review to catch what a single model misses.

code-reviewmulti-modelquality-assurancesubagents
by mattferry Jul 15, 2026 7/10
skill GitHub

Claude Code Tips: Practical Patterns from Hundreds of Sessions

A curated collection of practical patterns for agentic coding built from hundreds of Claude Code sessions — covering hooks, agents, and automation techniques with real-world examples.

best-practiceshooksagentsautomationpatterns
by anipotts Jul 15, 2026 7/10
skill Reddit

How Claude Decides to Load Skills: Frontmatter Description Is the Key

Claude loads a skill based on its description line, not its body — a vague description gets ignored while a trigger-specific one fires reliably. Covers the project vs user layer split (.claude/ in repo vs ~/.claude/), and common failure modes like hardcoding personal preferences into team CLAUDE.md files.

skillsclaude.mdconfigurationbest-practicesfrontmatter
by Bulky_Ad738 Jul 15, 2026 9/10
skill GitHub

AgentsCamp Library: Installable AI Coding Agent Skills Collection

A copy-paste-ready mirror of the agentscamp.com library, containing AI coding agent skills, commands, guides, and tools you can install directly. Makes community-published resources available as a Git-installable package. Good starting point for expanding Claude Code capabilities with curated community content.

skillscommandslibrarycommunityagents
by imtiazrayhan Jul 15, 2026 7/10
skill GitHub

Ghost Headless Blog Skill for Claude Code

A Claude Code skill for building a headless Ghost CMS blog with Next.js App Router, including Content API client, ISR with webhook revalidation, SEO configuration, and Koenig card styling. Packages a complete headless CMS stack into a reusable skill. Ideal for developers who use Ghost as a backend with modern React frontends.

skillghost-cmsnext.jsheadlessblog
by kasuncfdo Jul 15, 2026 5/10
skill GitHub

Starks Skill: Tiered Task Launcher for Claude Code

A task-launcher skill for Claude Code and Codex featuring tiered workflows, optional cross-model plan review between Claude and Codex, and PM-mode parallel sub-agents. Lets you kick off complex multi-step tasks with built-in checkpoints and model arbitration. Good for teams coordinating work across multiple AI coding tools.

skilltask-launcherworkflowcodexparallel-agents
by uniStark Jul 15, 2026 7/10
skill GitHub

Giasip Skills: Research and Multi-Model Dispatch for Claude Code

Two Claude Code skills: Quick Recon for rapid research with fact-checking, and a multi-model caller for dispatching tasks across different AI providers. Useful for building Claude Code workflows that need external information gathering or want to compare outputs from multiple models. Bilingual documentation in Chinese and English.

skillresearchfact-checkmulti-modeldispatch
by GiaSip Jul 15, 2026 6/10
skill GitHub

YouTube-to-Spec: Turn Videos into Traceable Software Requirements

Two decoupled Claude Code skills: one extracts lossless metadata and transcripts from YouTube videos, and a second transforms the transcript into Module → Feature → Requirement specs with every requirement linked to its exact transcript segment. Useful for turning conference talks, demos, or tutorial videos into structured specs. Ensures traceability from source material to requirements.

skillrequirementsyoutubetranscriptspecs
by alikmlsipahi Jul 15, 2026 7/10
skill GitHub

Creeta Lens: Skill Navigator for Claude Code

A skill navigator that helps Claude Code users discover, browse, and select the right skills for their task. Addresses the challenge of finding relevant skills in a growing ecosystem. Useful as a meta-tool for teams building large skill libraries.

skillnavigatordiscoveryclaude-code
by livevil7 Jul 15, 2026 5/10
skill GitHub

Data Engineering Skills for Claude: Guides, Prompts, and Python Code

A practical guide collection with prompts and Python code for applying Claude Skills to data engineering and pipeline automation tasks. Covers common data engineering patterns adapted for use with Anthropic's Claude Skills API. Useful for data engineers who want to automate ETL, pipeline validation, and transformation logic with Claude.

data-engineeringskillpythonpipelineetl
by Methasit-Pun Jul 15, 2026 6/10
skill GitHub

12 Principles for Writing Predictable Agent Skills

Evidence-backed guide to 12 principles for writing reliable, predictable agent skills, inspired by Matt Pocock's public skills repository. Covers composition, clarity, and testability for Claude Code skill authors. A valuable reference for anyone building reusable skills who wants to avoid common pitfalls. Bilingual (Chinese and English).

skillbest-practicesguideprinciplesagent-design
by Conradgui Jul 15, 2026 7/10
skill GitHub

github-publish-skill: Agent-Native Skill for Publishing Local Projects to GitHub

A Claude Code skill that automates publishing local projects to GitHub with zero-config proxy detection. Handles git init, remote setup, and push from within an agent session — designed to run unattended without manual credential configuration.

githubpublishinggitautomation
by zhongwentuo-creator Jul 15, 2026 7/10
skill GitHub

shirabe: Structured Workflow Skills for AI Coding Agents

A collection of structured workflow skills for AI coding agents providing organized patterns for common development tasks. Gives agents repeatable, well-defined processes rather than ad-hoc problem solving, improving consistency across sessions.

workflowskillsstructuredcoding-agents
by tsukumogami Jul 15, 2026 7/10
skill GitHub

solidifier: SOLID Principles Skill That Treats Over-Engineering as a Defect

A Claude Code skill (also compatible with OpenCode, Copilot, Codex) that applies SOLID design principles and patterns while treating over-engineering as a bug — every abstraction needs concrete justification. Offers four configurable rigor levels from advisory to thorough.

soliddesign-patternsrefactoringskill
by FernandoJRR Jul 15, 2026 8/10
skill GitHub

arc: Package Manager for Installing and Sharing AI Skills, Tools, and Agents

A package management system for personal AI that allows users to install, discover, and share skills, tools, agents, and prompts. Aims to create a discoverable ecosystem for AI extensions similar to how npm works for JavaScript packages.

package-managerskillsagentsdiscovery
by the-metafactory Jul 15, 2026 6/10
skill Reddit

Doodler: Draw on Your Screen to Show Claude What You Mean

A Claude Code skill plus macOS companion app that turns your screen into a transparent drawing canvas. Annotate live UI with circles and arrows while speaking, then Claude receives annotated screenshots plus a voice transcript. Transcription runs on-device via Apple SpeechAnalyzer — no API key, 100% local.

visualscreen-annotationmacosvoiceskillaccessibility
by obaid83 Jul 14, 2026 8/10
skill GitHub

MSP Claude Plugins: Plugins for PSA, RMM, Documentation Tools

Community-driven Claude Code plugins for managed service provider tooling covering PSA, RMM, and documentation systems. Open for community contributions — aimed at MSP engineers who want AI coding agent support for their day-to-day tools.

msppsarmmdocumentationpluginscommunity
by wyre-technology Jul 14, 2026 6/10
skill GitHub

Sketchloop: AI Agent Creates Hand-Drawn Diagrams via D2

Lets coding agents produce beautiful hand-drawn-looking diagrams authored as D2 text and rendered offline without a browser. The agent self-checks results by reading the PNG output to ensure the diagram matches the specification.

diagramsd2visualizationofflineself-checkskill
by alexander-posztos Jul 14, 2026 7/10
skill GitHub

Aguara: Scan Agent Skills and MCP Servers for Injection Threats

Scans AI agent skills and MCP servers for prompt injection vulnerabilities, data leak risks, and supply-chain threats before deploying to production. Produces actionable security reports covering each detected risk category.

securityprompt-injectionmcpskillssupply-chainscanning
by salasi1204 Jul 14, 2026 8/10
skill GitHub

Project Design Skill: Complete Planning Packages for Claude Code

A Claude Code skill that assembles complete software project planning packages on demand — architecture proposals, task breakdowns, and design decisions in a structured format suitable for handoff to implementation agents.

planningdesignskillarchitecturesoftware-design
by alfred-intelligence Jul 14, 2026 6/10
skill GitHub

SkillForge: Production-Ready Claude Code Skills for Devs

A curated set of production-ready Claude Code skills for developers, knowledge workers, and marketers. Includes 9 free MIT-licensed skills covering common workflows plus a Pro pack with extended capabilities.

skillsproduction-readymarketingdevelopmentmit
by moses607 Jul 14, 2026 6/10
skill GitHub

Wine on macOS AI Agent Skill: Run Windows Apps

A comprehensive AI agent skill and reference guide for running any Windows application on macOS via Wine, CrossOver, Whisky, and Kegworks. Covers bottle configuration, DXVK, .NET, crash fixes, and anti-cheat limits for AI agents including Claude Code, Codex, and Cursor.

winemacoswindowsskillcompatibilitygaming
by artificialguybr Jul 14, 2026 6/10
skill GitHub

Align-Dev: Generate SKILL.md Files via Visual Interface

A visual interface for generating frontend project standards and local SKILL.md files for AI coding agents. Helps teams create consistent agent instructions without hand-writing specification files from scratch.

skill-mdfrontendstandardsvisualconfiguration
by Villa3650 Jul 14, 2026 6/10
skill GitHub

CC Commander: 71 Skills, 22 Agents, 23 Hooks Plugin Suite

A comprehensive Claude Code plugin suite implementing "The Fable Method" — 12 enforceable quality gates to produce Fable-shaped results from any model. Bundles 71 plugin skills, 22 specialist agents, and 23 lifecycle hooks (39 handlers) in one installable package.

skillsagentshooksfablequality-gatesplugin-marketplace
by KevinZai Jul 14, 2026 8/10
skill GitHub

Air-Gapped Skills: 40+ Reference Skills for Infra and ML

A Claude Code plugin marketplace with 40+ installable reference skills covering vLLM/SGLang inference, Kubernetes and Harvester, GPU host bring-up, observability, security hardening, and agent workflows. Targeted at ML infra and DevOps teams.

skillskubernetesgpusecurityobservabilityinfravllm
by air-gapped Jul 14, 2026 7/10
skill GitHub

100+ Claude Code Skills Collection in Chinese

A curated collection of 100+ Claude Code skills with 18 original installable skills organized by use case. Instructions in Chinese, covering common development scenarios from code review to deployment automation.

skillschinesecollectioninstallableproductivity
by laolaoshiren Jul 14, 2026 6/10
skill GitHub

Trust-Issues: Adversarial Security Review Before You Install

A read-only scanner plus five-persona reasoning pass for AI skills, repos, MCP servers, and packages before installation. Produces a GO / GO WITH MITIGATIONS / NO-GO verdict with rationale to protect against supply-chain threats.

securityreviewmcpskillssupply-chainadversarial
by howshannon Jul 14, 2026 8/10
skill GitHub

Apple Music TUI and CLI Skill for Claude Code on macOS

Gives Claude Code and the macOS terminal full control over Apple Music — playback, multi-room AirPlay switching, and playlist management. Works as both a TUI and a natural-language skill invocation from Claude Code.

apple-musicmacostuicliskillairplay
by anthonymaley Jul 14, 2026 6/10
skill GitHub

Resume ATS Optimizer Skill for Claude Code

A Claude Code skill for building, tailoring, and auditing resumes optimized for ATS systems (Workday, Greenhouse, Lever, Taleo, iCIMS), recruiter skim-reading, and LinkedIn recruiter search. Zero-fabrication policy enforced by the skill.

resumeatslinkedincareerskill
by artificialguybr Jul 14, 2026 6/10
skill GitHub

Product Prover: Catch PRD Defects Before Writing Code

A Claude Code skill that applies formal-verification thinking to review PRDs and specs for structural defects before implementation begins. Every finding is traced back to its source requirement for accountability.

prdspec-reviewformal-verificationplanningskill
by happysasha18 Jul 14, 2026 7/10
skill GitHub

Orchestrate: Nine-Strategy Subagent Skill for Claude Code

A single /orchestrate entry point that dispatches to nine different subagent orchestration strategies (parallel, pipeline, review-loop, etc.). Lets you pick the right strategy per task without maintaining separate skills for each pattern.

orchestrationsubagentsskillstrategiesworkflow
by gabros20 Jul 14, 2026 7/10
skill GitHub

40+ Claude Code Tips with dx Plugin and Status Line Script

A curated collection of 40+ Claude Code tips from basics to advanced. Includes a custom status line bash script, a guide for running Claude Code inside a container, and the dx plugin with everyday dev workflow skills.

tipsskillspluginstatus-linecontainerproductivity
by ykdojo Jul 14, 2026 7/10
skill GitHub

Image Generation Inside Claude Code via /imagine

Adds image generation and editing to Claude Code through a skill and /imagine commands. Supports Codex CLI (no API key), OpenAI gpt-image, Gemini Nano Banana, and free FLUX models via an installable plugin marketplace.

image-generationskillcommandsfluxopenaigemini
by JashanMaan28 Jul 14, 2026 7/10
skill GitHub

Arcjet Security Skills for AI Coding Agents

Skills that give AI coding agents deep knowledge of the Arcjet security library for Node.js. Enables agents to correctly implement rate limiting, bot detection, and shield protection without manual documentation lookups.

securityarcjetnodejsskillsrate-limiting
by arcjet Jul 14, 2026 6/10
skill Reddit

Stop Plain Text Prompts: Switch to XML for Claude Code Tasks

Argues that framing Claude Code tasks in XML (structured task, context, constraints, output format) improves output quality more than upgrading models. Provides practical before/after examples and the technique's mechanics for formatting complex multi-step tasks.

promptingxmltechniqueskill
by reddit Jul 14, 2026 7/10
skill Reddit

5 Security Checks for Claude Wired into GitHub Actions

Security guide covering the five key questions that determine whether a Claude agent in GitHub Actions can be hijacked: write token scope, shell access, prompt injection from issue text, OIDC vs static secrets, and rate-limiting on untrusted input. Practical checklist for CI/CD Claude setups.

securitygithub-actionsci-cdprompt-injection
by reddit Jul 14, 2026 8/10
skill GitHub

repo-audit: Six-Phase Code Safety Audit Before You Install Third-Party Code

Claude Code skill that audits third-party code before installation. Runs six read-only phases and returns a SAFE / SAFE-WITH-CONDITIONS / UNSAFE verdict with evidence. Designed to catch supply chain risks, malicious payloads, and dependency traps before they enter your project.

securityauditskillsupply-chain
by belschak Jul 14, 2026 8/10
skill GitHub

tastecheck: 15 Frontend Craft Skills for AI Coding Agents

Fifteen skills that interview or audit an AI coding agent into a real design system, then verify typography, OKLCH color, component states, forms, charts, accessibility, and anti-slop patterns. Raises the bar on AI-generated UI output beyond functional to genuinely polished.

frontenddesignskillui-quality
by KyaniteLabs Jul 14, 2026 7/10
skill GitHub

decant: Extract Any Website's Design Language into Agent-Readable Instructions

Give your AI coding agent taste. Decant analyzes any website and extracts its design language — colors, typography, spacing, component patterns — into a structured format that coding agents can follow when generating UI. Bridges the gap between "design a page like this" and actually matching the style.

designskillfrontendui
by Ykjc720 Jul 14, 2026 7/10
skill Reddit

invisible-ink: Skill That Teaches AI Agents to Write Better UI Copy

Open-source skill based on Apple HIG, WWDC talks, and UX writing practice. Teaches AI agents to write human UX copy — buttons, error messages, empty states, forms — instead of generic machine-style text like "An error occurred." Includes before/after examples.

skillux-writingcopywritingfrontend
by reddit Jul 14, 2026 7/10
skill GitHub

ai-guidelines-sync: Sync Centralized Rules and Skills Across Projects

Tool for setting up and keeping centralized CLAUDE.md rules and skill files synchronized across multiple projects. Changes to the central rules propagate automatically, ensuring consistent agent behavior across an entire repository portfolio.

skillclaude-mdsyncproject-management
by artemisia-absynthium Jul 14, 2026 7/10
skill GitHub

design-harness: Feed Papers and Ideas, Get a Defensible System Design

Agent skill for Claude Code and any SKILL.md-compatible agent. Feed it papers and half-formed ideas; it links them into a system design you can defend. Keeps a Markdown record and generates a visual canvas. Useful for architecture and technical design work.

skillarchitecturedesignsystem-design
by tigerless-labs Jul 14, 2026 7/10
skill GitHub

claude-code-skills: Session Management, Worktree Recovery, and Skill Scaffolding

Production-tested skill collection covering session lifecycle management, multi-session reconciliation, worktree recovery after crashes or conflicts, and scaffolding for creating new skills. Addresses day-to-day operational pain points in Claude Code workflows.

skillsession-managementworktreescaffolding
by conorbronsdon Jul 14, 2026 7/10
skill GitHub

agent-token-saver: Measured Token Routing for Claude Code and Other CLI Agents

Reduces token waste by routing agent interactions through structured filters that strip noise without losing essential context. Works with Claude Code, Codex, Hermes, GG Coder, and other CLI agents. Aims to improve signal-to-noise while preserving judgment quality.

tokensoptimizationskillrouting
by Supersynergy Jul 14, 2026 6/10
skill GitHub

honest-loop: Evidence-Capped Quality Loop for AI-Built Work

Three-skill package addressing the problem that AI agents grade their own work too generously. Skills: score (evaluate the output), close-gaps (fix what the scorer found), and verify (independent check). Evidence-capped means the scorer can't mark something correct without concrete evidence.

skillqualityself-reviewverification
by youkistudios Jul 14, 2026 7/10
skill GitHub

basecamp: Production-Ready Claude Code Setup with CLAUDE.md and Token Optimization

Opinionated, production-tested Claude Code setup: global CLAUDE.md, coding rules, per-project memory, and token optimization patterns. Provides a solid starting point for a consistent, efficient Claude Code environment across all projects.

claude-mdconfigurationtoken-optimizationsetup
by janmaaarc Jul 14, 2026 7/10
skill GitHub

klaussy-agents: Multi-Agent Context, Rules, and Hooks Boilerplate Generator

Single command scaffolds conventions, namespaced skills, stack-appropriate settings, and interactive guardrails for seven AI coding environments — matching each agent's native file formats. Eliminates the work of manually adapting CLAUDE.md and settings for each tool.

scaffoldingboilerplatemulti-agentconfiguration
by steph-dove Jul 14, 2026 8/10
skill GitHub

atlassian-skills: Token-Efficient CLI for Atlassian Tools for LLM Agents

Drop-in alternative to mcp-atlassian for AI coding agents working with Jira, Confluence, and Bitbucket on Atlassian Server/DC. Outputs compact representations with lossless XHTML-to-Markdown round-trip. Compatible with Claude Code, Codex, and GitHub Copilot.

skillatlassianjiraconfluence
by eunsanMountain Jul 14, 2026 7/10
skill GitHub

fable5-mode: Fable 5 Work Discipline for Any Claude Model

Claude Code skill + guard hooks that make Opus 4.8 or any non-frontier model plan, self-verify, and route sub-agents like Fable 5 does. Includes a plan gate that blocks implementation without a written plan, a model ceiling hook, and per-task enforcement.

skillhookplanningmodel-discipline
by cozytab Jul 14, 2026 8/10
skill GitHub

delegate-to-lower-model: Always-On Skill Router for Lower-Cost Models

Claude Code skill that acts as a persistent router: identifies fixed-spec, machine-verifiable tasks and delegates them to lower-cost models (Haiku, Sonnet) while keeping quality tasks on the primary model. Designed so the quality floor never drops below single-model baseline.

skillroutingcost-optimizationmodels
by Laki-private Jul 14, 2026 7/10
skill GitHub

self-evolve: Methodology Skill for Agents That Self-Iterate Any Skill or Repo

Skill + harness for agents that self-improve their own skills or projects through multiple iterations. Uses an un-gameable acceptance gate so "accepted = real improvement" not a score-up curve. Built for open-ended domains without ground truth. 521 tests.

skillself-improvementiterationquality
by DaizeDong Jul 14, 2026 8/10
skill GitHub

reality-check-skill: Devil's Advocate Skill with 7 Decision Frameworks

Claude skill that pushes back on your ideas with evidence rather than agreeing by default. Four modes (soft challenge, hard challenge, scenario simulation, devil's advocate) grounded in seven decision frameworks including pre-mortem, inversion, and steelman.

skilldecision-makingcritical-thinkingreview
by ibangtam Jul 14, 2026 7/10
skill GitHub

murderboard: Skill That Tries to Kill Your Idea Before You Commit

Claude will tell you your idea is great. Murderboard makes it try to kill it first. A structured adversarial review skill that argues against your proposal, identifies failure modes, and surfaces risks — before you commit engineering effort to it.

skilladversarialreviewidea-validation
by acost1a Jul 14, 2026 7/10
skill GitHub

ai-toolkit: 94 Skills and 44 Agents for Multi-Platform AI Coding

Large-scale professional AI coding toolkit with 94 skills and 44 agents. Works across Claude Code, Cursor, Windsurf, Copilot, Gemini, Cline, Roo Code, Aider, Augment, Antigravity, Codex CLI, and opencode. Covers a broad spectrum of development tasks.

skillmulti-platformtoolkitagents
by softspark Jul 14, 2026 7/10
skill GitHub

architect: Read-Only Architecture Review Skill for AI Coding Agents

Skill for grounded architecture review and design — read-only, evidence-based, grounded in Balanced Coupling principles. Reviews existing architecture and generates executable improvement plans. Designed for cases where you want architectural analysis without code changes.

skillarchitecturereviewdesign
by alexei-led Jul 14, 2026 7/10
skill GitHub

basicly: Versioned Harness Distribution for Coding Agents

Maintains reusable skill fragments, hook gates, and settings in one source of truth, then projects them into the native format of each target tool (Claude Code, Cursor, etc.). Version-pins the distribution so you can roll back or upgrade consistently.

skillharnessdistributionconfiguration
by niksavis Jul 14, 2026 7/10
skill GitHub

Claude-Skills: Token Optimization with TDD Methodology Including rescue-tokens

Community Claude Code skill library tested with TDD (RED-GREEN-REFACTOR). Features rescue-tokens skill: 9 optimization patterns that reduce verbosity by 90% to avoid rate limits. Includes session management and productivity workflow skills.

skilltoken-optimizationtddproductivity
by valorisa Jul 14, 2026 7/10
skill GitHub

gemini-delegate-skill: Claude Code Skill for Delegating to Gemini CLI

Skill that routes specific tasks from Claude Code to Gemini CLI: large-context synthesis (leveraging Gemini's 1M+ context window), English or Chinese long-form drafting, and second-opinion review. Enables a two-model workflow from within Claude Code.

skillgeminidelegationmulti-model
by WenyuChiou Jul 14, 2026 7/10
skill GitHub

creative-sparring: Adversarial Ideation Skill for Claude and Cursor

Frames, diverges, attacks, and bridges product ideas into falsifiable prototype briefs. Goes beyond "yes, and" to genuinely stress-test product concepts through structured adversarial ideation. Works with Claude Code, Cursor, and Codex.

skillideationadversarialproduct
by mondaymetime Jul 14, 2026 7/10
skill GitHub

mcp-precheck: Skill That Checks MCP Servers Against PolicyLayer Registry

Agent skill that checks any MCP server against the PolicyLayer security registry before connecting. Returns identity verification, risk grade, tool classifications, and detected changes. Prevents connecting to malicious or compromised MCP servers.

skillsecuritymcpregistry
by PolicyLayer Jul 14, 2026 7/10
skill GitHub

coding-quality-loop: Portable Skill for Small Verified Coding-Agent Changes

Agent skill that enforces a quality loop for coding changes: plan the change, implement it minimally, verify with tests, and only commit when verified. Designed to prevent AI agents from making large untested changes in a single step.

skillqualityverificationtesting
by zaingz Jul 14, 2026 6/10
skill GitHub

SvelteKit Project Structure Skill for Claude Code

A reusable Claude Agent Skill acting as a senior software architect for SvelteKit projects. Helps design structure, review existing setups, detect problems, and plan migrations. Good for teams standardizing their SvelteKit architecture.

sveltekitskillarchitectureproject-structure
by poolcamacho Jul 13, 2026 5/10
skill GitHub

Claude Code Skills for Apple Platform Development

A collection of Claude Code skills targeting iOS, macOS, and iPadOS development. Covers product validation, code generation, and App Store optimization. Purpose-built for Apple developers using Claude Code.

appleiosmacosskillapp-storeswift
by rshankras Jul 13, 2026 7/10
skill GitHub

Aident Loadout: Connect AI Agents to 27,000+ App Actions

A Claude Code skill that connects agents to over 1,000 real-world apps (Gmail, Slack, Linear, Notion, Firecrawl, Fal) with 27,000+ executable actions and full audit history. Bridges Claude Code to third-party integrations without custom MCP servers.

skillintegrationsgmailslacknotionautomation
by Aident-AI Jul 13, 2026 6/10
skill GitHub

computed-skills: Context-Adaptive Claude Skills via Runtime Scripts

A framework for writing Claude Code skills that dynamically adjust their instructions based on real-time data — running scripts at invocation time to tailor agent behavior to current conditions. Enables skills that respond to environment, config, or live state.

skilldynamicruntimecontext-awareautomation
by nkwem3002 Jul 13, 2026 7/10
skill GitHub

pdf-trust-skill: PDF Authenticity Auditing via Claude Skill

A Claude Skill that orchestrates PDF MCP servers to audit document trustworthiness: cryptographic signature verification, tamper detection, PAdES/PDF-A compliance, and optional Japanese-law cross-referencing. Returns a trust score with detailed findings.

skillpdfsecuritycryptographysignaturecompliance
by shuji-bonji Jul 13, 2026 7/10
skill GitHub

claude-content-skills: Social Media Content Factory Skills

Free, copy-paste Claude skills for a content production pipeline: turn ideas and NotebookLM memory into Instagram reels scripts. Demonstrates using Claude skills to automate social media content workflows.

skillcontentsocial-mediainstagramautomation
by Ootto-AI Jul 13, 2026 5/10
skill Reddit

Claude Code Plugin: Full Design System Scaffolder for Figma and Code

A Claude Code plugin with 12 skills and 10 reference docs that generates a complete design system in both Figma and code output, with model tiering for cost efficiency. Automates the most tedious part of starting a new design system.

skilldesign-systemfigmauipluginscaffolding
by jerpes1 Jul 13, 2026 7/10
skill GitHub

brand-book-studio: Generate PDF Brand Books with Claude Skill

A Claude skill and plugin combo that generates complete PDF brand books and AI brand guardrail files for any business. Automates the deliverable creation step of brand identity work.

skillbrandpdfdesignplugin
by spotozkin Jul 13, 2026 5/10
skill Reddit

Screenshot Delivery Skill for Remote Claude Code Sessions

A Claude Code skill for sending screenshots from phone or PC to a headless Claude server. Uses a Nextcloud (or Syncthing/SFTP) sync folder and a skill that finds the newest file — works identically from any device. Solves the screenshot paste limitation in remote terminals.

skillscreenshotremoteheadlessservermobile
by karangos Jul 13, 2026 7/10
skill GitHub

Luxembourg-Paperasse: AI Skills for Luxembourg Bureaucracy

A collection of AI skills for Luxembourg administrative tasks: accounting, VAT, RCS/LBR filings, eCDF, FAIA, PAdES, notary work, and co-ownership (copropriété). Published on AgentSkill.sh. Useful for professionals handling Luxembourgish compliance.

skillluxembourgcomplianceaccountingtaxlegal
by gregherbe76 Jul 13, 2026 5/10
skill GitHub

superpowers-v: Triple-Parallel Pre-Flight Skill with Disjoint File Partition

Compound V is a companion to the Superpowers skill that adds triple parallel pre-flight (code archaeology, domain-expert search, library/doc validation via Context7), a Disjoint File Partition Map, and batched parallel Opus dispatch. Auto-intercepts brainstorming-to-execution transitions.

skillparallelpre-flightcontext7opusworkflow
by procoders Jul 13, 2026 7/10
skill GitHub

Academic Research Skills for Claude Code

A Claude Code skill set for organizing real academic research workflows. Includes literature tracing, source verification, and bilingual paper search, making research more systematic and reproducible.

academicresearchskillliterature
by gretamutualist474 Jul 13, 2026 6/10
skill GitHub

Claude Code Organizer: AI Index and Module Map

A tool to organize Claude Code projects with a clear AI index, module map, and fast codebase navigation. Helps agents and developers orient quickly in large codebases.

organizationcodebasenavigationskill
by ianpugfaced55 Jul 13, 2026 6/10
skill GitHub

TeamRetro AI Retrospective Skills

Skills and prompts that let AI team members gather reflections and bring them to sprint retrospectives. A practical integration of Claude Code into agile workflows.

retrospectiveagileteamskill
by TeamRetroHQ Jul 13, 2026 6/10
skill GitHub

AI Job Search Skill for Claude Code

A Claude Code skill to automate job searching by analyzing roles, customizing resumes, drafting cover letters, and practicing interview responses. Turns Claude Code into a personal career assistant.

job-searchresumecareerskill
by Ergi8957 Jul 13, 2026 5/10
skill GitHub

Humanities Writing Companion: 11-Mode Writing Assistant Skill

A comprehensive Agent Skill for humanities writing with 11 modes spanning Socratic research-question sharpening through AI-use disclosure. Bilingual (EN/中文), discipline-aware across literature, history, philosophy, and more, with four-layer critique and voice preservation.

writinghumanitiesbilingualcritiqueskill
by tizzy916 Jul 13, 2026 7/10
skill GitHub

21 Agentic Design Patterns as a Claude Code Skill

A design-phase reference distilling 21 agentic design patterns into concepts (no code), packaged as a Claude Code skill. Ideal for architecture planning sessions before building AI agent systems.

design-patternsarchitectureagentsskillreference
by eshwarvijay Jul 13, 2026 8/10
skill GitHub

Pingouin Psychology Statistics Skill for Claude Code

A skill plugin for Claude Code and other AI agents providing safe, reproducible Pingouin-based workflows for psychology statistics. Includes assumption checks, S0–S5 supervision gates, and APA-style reporting.

statisticspsychologypingouinresearchskill
by Exekiel179 Jul 13, 2026 6/10
skill GitHub

Agent Skills Catalog for Codex and Repo Maintenance

A public catalog of Agent Skills covering Codex operations, repo maintenance, skill maintenance, productivity, and engineering workflows. A curated library of reusable skills for common developer tasks.

catalogcodexrepo-maintenanceskill-library
by stark-ai-de Jul 13, 2026 6/10
skill GitHub

Fiction Writing Skills for Claude Code: Augmentation-Only

Augmentation-only Agent Skills for fiction writers — editors, critique simulators, character work, and craft drills. Notably reads and critiques manuscripts without ghostwriting, keeping the author's voice central.

fictionwritingcritiqueeditingskill
by Calliope-Editor Jul 13, 2026 7/10
skill GitHub

LinkedIn Growth Skills for Claude Code Terminal

Claude Code and Codex skills for LinkedIn growth: write human-sounding posts, craft comments, analyze feed, and build a publishing cadence from the terminal. Useful for founders and marketers.

linkedinmarketingsocial-mediaskill
by sergebulaev Jul 13, 2026 5/10
skill GitHub

Government Contracting Agent Skills (CLEATUS MCP)

Installable Agent Skills for government contracting, including Claude Code plugins and playbooks driving the CLEATUS MCP server. Specialized skills for navigating federal contracting workflows.

governmentcontractingmcpskill
by cleatai Jul 13, 2026 6/10
skill GitHub

X/Twitter Marketing Skills for Claude Code and Codex

Skills for writing tweets, threads, and replies in your authentic voice, stripping AI tells, and publishing via Publora. Designed for content creators using Claude Code from the terminal.

twitterxsocial-mediamarketingskill
by sergebulaev Jul 13, 2026 5/10
skill GitHub

PRD to Implementation-Ready Specs Agent Skill

An Agent Skill that transforms rough PRDs and product requirements into implementation-ready specifications. Bridges the gap between product thinking and developer-ready technical specs.

prdspecificationsproduct-managementskill
by wair56 Jul 13, 2026 7/10
skill GitHub

Dungeons and Skills: Grounded D&D 2024 Character Builder

A D&D 2024 (5.5) character-builder skill pack that reads a bundled rules catalogue and uses a deterministic engine instead of hallucinating. Demonstrates grounded AI skills with verifiable outputs.

dndgamegroundeddeterministicskill
by mlabarrere Jul 13, 2026 6/10
skill GitHub

Claude Code for Product Managers: 10 Terminal Skills

Ten terminal skills equipping Product Managers to streamline planning, execution, research, debugging, and deliverable creation using Claude Code. Bridges PM workflows with AI-assisted terminal tooling.

product-managementpmterminalskill
by SOAIF0099 Jul 13, 2026 6/10
skill GitHub

Awesome CLAUDE.md Templates for Major Tech Stacks

Ready-to-use CLAUDE.md templates for major technology stacks to improve Claude Code outputs and streamline project setup. A curated library of context files that give Claude the right project conventions from the start.

claude-mdtemplatesproject-setupconventionsboilerplate
by anns2rn Jul 13, 2026 8/10
skill GitHub

AceDataCloud Agent Skills: Media Generation and Web Search

Agent Skills for AceDataCloud AI services covering music, image, and video generation plus web search. Compatible with Claude Code, GitHub Copilot, Gemini CLI, and agentskills.io-compatible agents.

media-generationimagevideomusicweb-searchskill
by AceDataCloud Jul 13, 2026 6/10
skill GitHub

Throughline: Cut Claude Code Context Usage by 90%

A technique and tooling that cuts Claude Code's context window usage by approximately 90% while preserving nearly all the relevant memory. Addresses one of the most practical limitations in long Claude Code sessions.

context-managementmemoryefficiencyoptimization
by kitepon-rgb Jul 13, 2026 8/10
skill GitHub

Skill-Guide: Scan Agent Skills and Generate Slide Decks

A skill that scans your installed agent skills and generates HTML slide decks to track and present your automation tools. Useful for documenting and sharing your skill library.

documentationskill-managementhtmlslides
by Coldwavegenusthespesia630 Jul 13, 2026 5/10
skill GitHub

Social Media Scraper Skill for Claude Code

A Claude Code skill for extracting and summarizing social media content from Instagram, TikTok, X, and YouTube. Enables agent-driven social media research and content analysis.

social-mediascrapinginstagramtiktokskill
by expropriationhoorayhenry64 Jul 13, 2026 5/10
skill GitHub

Claude Voice: TTS Skill with Lifelike Expressions

A skill that gives Claude Code a voice using Speechify's lifelike TTS with expressions. Enables audio output from Claude Code sessions for accessibility or ambient coding workflows.

ttsvoiceaccessibilityspeechifyskill
by AnimaEcho Jul 13, 2026 7/10
skill GitHub

Interview-Me: Staff-Level Interview and Review Skills

Two staff-level Agent Skills for Claude Code: interview-me-senior grills and scores your architectural decisions; review-me-senior is a code review copilot with auto-detected best-practice packs for C#/.NET and Blazor/Fluxor.

code-reviewinterviewdotnetblazorskill
by connorjjarvis Jul 13, 2026 7/10
skill GitHub

Fable Reasoning Protocol: Think Before Answering Skill

A free AI skill that makes any model plan first, test competing ideas, and verify its work before answering. Works with Claude, Antigravity, Codex, and Cursor as a portable reasoning scaffold.

reasoningplanningverificationfableskill
by akhilguptahub Jul 13, 2026 6/10
skill Reddit

Production-Readiness Audit Claude Code Plugin

A Claude Code skill that audits apps for production readiness across five domains (frontend, backend, auth/security, infra, ops). Runs a fixed rubric every time — catching RLS-off Supabase configs, service_role key leaks, and missing rate limits — outputting scored reports with copy-paste fixes.

securityauditproduction-readinesssupabaseskillplugin
by kemalios Jul 13, 2026 8/10
skill GitHub

Relay: Context Handoff Between Claude Conversations

Carries a full Claude chat into a fresh conversation with one paste. Chat-native and domain-adaptive, letting you continue long sessions without losing context when starting a new window.

contexthandoffsession-continuitymemoryskill
by mosuvo Jul 13, 2026 7/10
skill GitHub

ASO Agent Skills: App Store Optimization

Nine Agent Skills for App Store Optimization powered by the ASOScan API. Compatible with Claude Code, Cursor, and agentskills.io-compatible assistants, with two skills requiring no API key.

asoapp-storeoptimizationmarketingskill
by ASOScan Jul 13, 2026 6/10
skill GitHub

Better Plan Mode: Interactive Visual Decision-Making

Transforms project planning in Claude Code into interactive, visual decision-making with multiple options, previews, comparisons, and a saved decision history. Improves the plan mode experience significantly.

plan-modedecision-makingvisualinteractiveskill
by LIPOKA Jul 13, 2026 7/10
skill GitHub

Sixtyfour: Live Web Data for Research and Lead Enrichment

A skill that enables AI agents to access live web data for in-depth people and company research, lead enrichment, contact discovery, and automated workflows. Connects Claude Code to real-time web intelligence.

web-dataresearchlead-enrichmentcontactskill
by Mtjones2501 Jul 13, 2026 5/10
skill GitHub

Narrative Skills Marketplace: Data Company Agent Workflows

An agent skills marketplace from Narrative I/O with interactive, AI-powered slash-command workflows for recurring data company work — NQL queries, Rosetta Stone mappings, identity graphs, and more. Follows the Agent Skills spec.

datamarketplacenqlidentityskill
by narrative-io Jul 13, 2026 7/10
skill GitHub

B2B Lead Finder Claude Code Skill

A Claude Code skill for finding, verifying, and prioritizing B2B leads in any city with evidence quotes, adversarial verification, 21 vertical-by-city presets, and Excel-ready output.

b2bleadssalesresearchskill
by Claudefarid Jul 13, 2026 6/10
skill GitHub

Korean Academic Paper Proofreading Skill for Claude Code

A Claude Code skill for proofreading Korean academic papers using sequential chunk checking across four axes (notation, sentences, logic, citations) with bibliography verification to flag hallucinated sources.

koreanacademicproofreadingcitationsskill
by parkjui92-tech Jul 13, 2026 6/10
skill GitHub

Strategic Partner: Chief of Staff Skill for Claude Code

A Claude Code skill that acts as a Chief of Staff — deciding what to execute rather than executing itself. Adds a strategic reasoning layer on top of your other Claude Code tools.

strategyplanningchief-of-staffdecision-makingskill
by JimmySadek Jul 13, 2026 7/10
skill GitHub

Context Summary: Seven-Block Session Handoff Skill

A Claude.ai Personal Skill that generates a structured seven-block session handoff so you can continue work in a new conversation without losing context, rediscovering decisions, or re-explaining project state.

contexthandoffsession-continuitymemoryskill
by thebpandey Jul 13, 2026 7/10
skill GitHub

React Principles Skills for Claude and Cursor

Agent Skills implementing React Principles cookbook patterns for Claude and Cursor. Codifies established React best practices as reusable skills for consistent code generation.

reactpatternscookbookfrontendskill
by sindev08 Jul 13, 2026 6/10
skill GitHub

Research Architect: Evidence-Backed Manuscript Draft Workflow

An end-to-end research workflow skill for turning ideas into evidence-backed, citation-supported manuscript drafts. Covers the full research pipeline from idea to polished draft.

researchmanuscriptcitationswritingskillworkflow
by mmTheBest Jul 13, 2026 6/10
skill GitHub

Caddie: Keep Agent Skills Organized Across Repos

A caddie for your agent skills that keeps them organized, up to date, and ready for every repository. Manages skill synchronization across multiple Claude Code projects.

skill-managementorganizationsyncrepos
by sreejithraman Jul 13, 2026 6/10
skill GitHub

Accessibility Skills for Claude Code

A collection of Claude Skills mirroring ACCESSIBILITY.md best practices. Helps AI agents produce more accessible code and content by encoding established accessibility guidelines as reusable skills.

accessibilitya11yskillbest-practices
by mgifford Jul 13, 2026 6/10
skill GitHub

TOON Memory: Persistent Memory for Agents (40% Fewer Tokens)

A persistent memory system for AI coding agents using the TOON format, which uses 40% fewer tokens than JSON. Provides compact, efficient memory that can be passed across sessions.

memorytoon-formattoken-efficiencypersistenceskill
by LuiggiVal08 Jul 13, 2026 7/10
skill GitHub

Beautify Flutter: Material 3 Design Skills for Claude Code

A Flutter UI/UX design skill for Claude Code, Cursor, and AI coding agents. Covers Material 3 theming, dark mode, animations, and anti-patterns to make Flutter apps look designed rather than defaulted.

fluttermaterial-3uidesignskill
by parasvishwa Jul 13, 2026 6/10
skill GitHub

Claude Configs: Share Claude Configurations Across Machines

A repository structure for sharing Claude Code configurations, skills, and agents across machines. Provides a convention for keeping your Claude setup synchronized.

configurationsyncsharingmachinesskill
by davidbaines Jul 13, 2026 6/10
skill GitHub

Deep Research Trigger: Portable /deep Research Agent Skill

A portable /deep research agent skill for Claude Code and OpenAI Codex that is cost-controlled, evidence-gated, multi-provider, and resumable. Provides structured deep research with guardrails.

researchdeep-researchevidence-gatedresumableskill
by jechiu16 Jul 13, 2026 7/10
skill GitHub

Domain-Search and SSR Market Research Skills

A Claude Code skills marketplace package with domain-search and SSR market research skills. Usable as plain skill folders in Codex and Cursor as well.

domainmarket-researchsearchskill
by thattimc Jul 13, 2026 5/10
skill GitHub

Mixture-of-Agents Skill: Multi-Model Committee for Claude Code

A multi-model committee skill (Mixture-of-Agents) for Claude Code that chairs up to 4 heterogeneous LLMs to blind-review, decide, and brainstorm in parallel with evidence-driven convergence for more reliable conclusions.

mixture-of-agentsmulti-modelcommitteeblind-reviewskill
by sdsrss Jul 13, 2026 8/10
skill GitHub

Claude Code Plugin for Elixir/Phoenix with 20 Specialist Agents

A comprehensive Claude Code plugin for Elixir, Phoenix, and LiveView featuring 20 specialist agents, Iron Laws enforcement, and Tidewave MCP integration. Supports parallel research agents, automatic verification, and 4-agent parallel code audits.

elixirphoenixliveviewspecialist-agentstidewaveskill
by oliver-kriska Jul 13, 2026 7/10
skill GitHub

App Development Planning Skill: Requirements, Architecture, and Roadmaps

A Claude Code skill for end-to-end application development planning, covering requirements analysis, feature planning, technology selection, system architecture, SDLC, milestones, and roadmaps. Helps structure complex projects thoroughly before writing any code. Drop-in skill for any new application development effort.

skillplanningarchitecturerequirementssdlcroadmap
by fullstackondemand Jul 13, 2026 7/10
skill GitHub

Stop Slop — Remove AI Writing Patterns from Your Output

A Claude skill that guides Claude and other LLMs toward clearer, more authentic prose by stripping common AI writing patterns. Useful for any output that needs to read naturally rather than like generated text.

writingproseai-patternsquality
by mohamedgame Jul 13, 2026 6/10
skill GitHub

Skillpack — Package Any OSS Library as an Agent-Discoverable Skill

Tool for wrapping any open-source library or CLI into a skill pack usable by Claude Code, Cursor, and Codex. Generates the distribution layer and verifies agents can actually invoke it.

skillsdistributioncross-agentcodexcursor
by nordicnode Jul 13, 2026 8/10
skill GitHub

Guardsman — AI Skill That Enforces Repo Standing Orders

Claude Code skill that reads your repository's existing conventions and rules, then evaluates every change by blast radius before allowing it through. Acts as an automated code guard that enforces project standards.

safetycode-reviewconventionsblast-radius
by hedimanai-pro Jul 13, 2026 7/10
skill GitHub

Skill Harness — Measure Whether a Claude Skill Actually Works

Pre-alpha testing framework that runs the same task with and without a skill and compares results honestly. UNMEASURED is a first-class verdict — it never fabricates a score when evidence is insufficient.

testingevaluationskillsmeasurement
by MrBinnacle Jul 13, 2026 7/10
skill GitHub

FOMO Kernel — Trade CSV Review Skill for Claude Code

Claude Code skill that converts a broker CSV into a single behavioral review card. Uses mechanical analysis for pattern detection and a master-lens layer to surface the motivations behind trades.

tradingfinancecsvbehavioral-analysis
by atomchung Jul 13, 2026 5/10
skill GitHub

Evergreen — Keep Documentation Honest with Real Code Citations

Language-agnostic Claude skill suite that detects documentation drift, certifies every claim against actual code, and rewrites prose only when evidence supports it. Cites the specific line or says nothing. Four modes: ride-along, winnow, flourish, cultivate.

documentationdriftcode-qualitycitations
by ChrisPachulski Jul 13, 2026 7/10
skill GitHub

Claude Code Settings — Commands and Agents for Vibe Coding

Collection of Claude Code settings, custom commands, and agent configurations curated for productive vibe coding sessions. A ready-to-use starting point for personalizing Claude Code behavior.

settingscommandsconfigurationvibe-coding
by feiskyer Jul 13, 2026 6/10
skill GitHub

MemoryCustodian — Project Memory Skill for Coding Agents

Agent skill that provides persistent project-level memory to coding agents. Helps maintain context across sessions without relying on in-context history alone.

memoryproject-memoryagentspersistence
by waittim Jul 13, 2026 7/10
skill GitHub

KiSYSTEM — Claude Code Skill Bundle for Clean Modular Code

Bundle of Claude Code skills that enforces clean, modular, human-readable code from the base of a project. Includes conventions for keeping AI-written code maintainable and consistent.

code-qualitybundlemodularconventions
by Pr1m4lc0d3 Jul 13, 2026 6/10
skill GitHub

Apple HIG Skill — Auto-Apply Apple Design Guidelines in Claude Code

Claude Code plugin that automatically applies Apple Human Interface Guidelines to UI designs across iOS, iPadOS, macOS, watchOS, tvOS, and visionOS. Enforces platform-native design standards in AI-driven UI work.

appleuidesignhigiosmacos
by aponeurosiswilling807 Jul 13, 2026 6/10
skill GitHub

Claude Academic Skills — 23 Skills for Quantitative Research

Curated bundle of 23 Claude Skills for quantitative research in business, finance, and social science, available in both Chinese and English. Covers statistical analysis, literature review, and research reporting workflows.

academicresearchfinancequantitativebilingual
by Nero1688 Jul 13, 2026 6/10
skill Reddit

SwiftShip: Claude Code Skills for App Store Review Compliance

A set of SKILL.md files that give Claude Code context about Apple App Store guidelines, required privacy manifest keys, metadata rules, and common rejection patterns. Covers entitlements validation and a pre-submission checklist against Guideline 4.0 and 5.1 failures. Useful for iOS developers using Claude Code who want to avoid costly App Store rejections.

swiftiosapp-storeskillagent-skillsapple
by Direct-Attention8597 Jul 12, 2026 7/10
skill GitHub

Content Editor Skill for Claude: Newsletter, Podcast, and Draft Editing

This Claude Skills package acts as a personal content editor, evaluating sources, outlining newsletters, editing drafts, and converting podcasts to text — all in a consistent voice. It serves as a design showcase for building personal workflow skills on top of Claude. Note: the actual skill contents are proprietary, but the package structure is public.

skillcontent-editingnewsletterworkflowvoice
by wei-wei-hu Jul 12, 2026 5/10
skill GitHub

claude-base: Opinionated Claude Code Foundation with TDD Workflow

An opinionated CLAUDE.md foundation with a built-in Explore → TDD → Audit workflow and auto-detected stack presets for Next.js, FastAPI, Astro, and others. Install via curl | bash. Useful for bootstrapping new projects with consistent agentic development practices.

claude.mdtddworkflowfoundationscaffoldpresets
by christopherlouet Jul 12, 2026 7/10
skill GitHub

ai-product-manager-skills: Product Management Workflows for Claude

A set of Claude/Codex agent skills covering brainstorming, product research, PRD workflows, requirements review, and planning handoff. Useful for product managers using Claude Code to structure and automate product development phases.

product-managementprdplanningskillsworkflow
by PANGKAIFENG Jul 12, 2026 5/10
skill GitHub

python-greenfield: Composable Agent Skills for TDD Python Projects

A set of composable agent skills for repeatable, test-driven greenfield Python project delivery. Standardizes the scaffolding and development workflow for new Python projects using Claude Code.

pythontddgreenfieldskillsscaffold
by dahyeK0420 Jul 12, 2026 6/10
skill GitHub

agent-harness: Self-Maintaining Project Context Memory for Claude Code

A Claude Code skills collection starting with project-context — a self-maintaining context memory that survives session resets and context-window compaction. Solves the cold-start problem without manual CLAUDE.md upkeep.

memorycontextsessionskillscompaction
by K021 Jul 12, 2026 7/10
skill Reddit

pluribus: Browser Tool for Syncing CLAUDE.md, AGENTS.md, and .cursorrules

A browser-only tool for keeping agent instruction files in sync across Claude, Cursor, and Codex. Edit one canonical rule and preview the native output for each tool, with source/output hash inspection. Addresses the problem of diverging agent configs across different coding tools.

claude.mdagents-mdcursorrulessyncconfigcross-tool
by Sensitive-Cycle3775 Jul 12, 2026 6/10
skill GitHub

Evidence-Backed Agent Skills That Retire When Models Outgrow Them

A curated skills library where every skill carries evidence of the real failure it addresses, gets re-tested on new model releases, and is publicly retired when models stop needing it. A principled alternative to skill collections that accumulate indefinitely.

skillsevidence-basedqualityretirementtestingbest-practices
by MrBinnacle Jul 12, 2026 8/10
skill GitHub

Claude-Arsenal: 25 Subagents + 14 Lifecycle Skills + CLAUDE.md Templates

A comprehensive toolkit with 25 Claude Code subagents, 14 lifecycle skills, and CLAUDE.md templates covering the full product development lifecycle from build to ship to monetize. Clone and run one sync command to get started.

subagentsskillsclaude.mdtemplateslifecycletoolkit
by T4LEL Jul 12, 2026 7/10
skill GitHub

engine-template: Claude Code Governance Scaffold for Non-Engineers

A Claude Code project template with pre-wired memory, contracts, policies, checks, and ops docs that lets a non-engineer direct and approve AI coding work without reading code. Bootstraps a repo with full governance infrastructure from day one.

governancetemplatenon-engineerscaffoldcontractsclaude.md
by StarshipSuperjam Jul 12, 2026 7/10
skill GitHub

ai-code-skills: Security, Performance, and Clean Code Review Skills

Agent skills for Claude Code, Codex, and OpenCode that review code for security, performance, and clean code quality. Includes Next.js and Laravel PR reviewers plus a stack-agnostic pre-push reviewer with a Pass/Warn/Fail scorecard.

code-reviewsecurityperformancepre-pushhookskills
by ezzatmakar Jul 12, 2026 7/10
skill GitHub

megapowers: Measured Skills, Plugins, and Hooks for AI Coding Agents

A collection of skills, plugins, and hooks for Claude Code, Codex, OpenCode, and Antigravity — described as "measured, not vibed." Targets behavioral changes to how coding agents work rather than cosmetic additions.

skillshookspluginsmeasuredmulti-toolbehavior
by lawzava Jul 12, 2026 7/10
skill GitHub

cognitive-deadlift: Skills and Hooks That Keep Developers Thinking

A collection of AI coding skills, hooks, and plugins designed to keep developers actively engaged rather than autopiloting through AI-generated code. Focuses on developer growth alongside AI assistance.

skillshooksdeveloper-growththinkingengagement
by alinafe82 Jul 12, 2026 6/10
skill Reddit

Usage advice

Sorry if this has been asked before: Context: I am on the pro plan, run about three automated tasks everyday. Noticed in past four days, after those three tasks usage is 100% finished. Previously, ...

skillworkflow
by AbbreviationsThis391 Jul 12, 2026 8/10
skill Reddit

Is it possible to use cc skills in openai?

After fable vs sol discussions, i decided to move towards openai side after 2yrs of claude subscription. I had some skills for dynamically creating human-like contents, so is it possible to use the...

skill
by SirBoranium Jul 12, 2026 6/10
skill GitHub

Armory: Standalone Claude Code Skills as Drop-In Folders

Framework for building standalone Claude Code skills as simple, drop-in folders that work with any codebase on any OS. Each skill is self-contained with no cross-dependency requirements.

skillportabledrop-instandalone
by allysgrandiose674 Jul 12, 2026 6/10
skill GitHub

DashiAI PPT Skill: AI Skill for Browser-Editable Presentations

An AI agent skill that generates browser-editable presentations from multiple visual themes, exportable to HTML, PDF, and PPTX. Enables agents to produce shareable slide decks directly from their output.

skillpresentationpptxhtmlexport
by chuspeeism Jul 12, 2026 6/10
skill GitHub

Paper Deep Reading Skill: Convert PDFs to Structured Obsidian Notes

Converts research paper PDFs into structured Obsidian notes with automated translations, figure analysis, and concept explanations for deep study. Useful for researchers using Claude Code agents to process academic literature.

skillresearchpdfobsidiannotesacademic
by Robertmorrisluminousenergy177 Jul 12, 2026 6/10
skill GitHub

Hand-Rolled AI Skills for Git and Mise Workflows

Curated, hand-rolled AI skills distilled from everyday development experience, covering Git workflows and Mise (polyglot tool version manager) automation. Practical skills focused on real daily use rather than theoretical patterns.

skillgitmiseworkflowpractical
by sherifabdlnaby Jul 12, 2026 6/10
skill GitHub

Claude Wayfinder: Deterministic Skill Dispatch with Typed Scoring Kernel

Deterministic and auditable agent/skill dispatch for Claude Code using a typed seven-decision scoring kernel that runs after reading the conversation — post-cognitive routing instead of prose-scanning. Auto-generates its dispatch catalog from skill sidecars and agent frontmatter.

routingdispatchskilldeterministicaudit
by glitchwerks Jul 12, 2026 7/10
skill GitHub

Fable 5 Handoff: Domain-Neutral Discipline Files for Any Agent Framework

The retirement handoff of Claude Fable 5, written by the model itself — domain-neutral discipline files that transfer Fable 5's working methodology to any model, agent framework, or team. A unique artifact documenting how Claude Fable 5 approached problems.

skillmethodologyfable5claudehandoffdiscipline
by pipipip169 Jul 12, 2026 7/10
skill GitHub

Memory Doctor: Detect and Repair Rotting Agent Memory Before Sessions

Agent memory rots quietly — this tool checks it before sessions pay the cost with status, lint, and compact commands for Claude Code and OpenClaw. Also embedded in brigade-cli for integrated memory hygiene.

memoryskillhygienelintcontext
by escoffier-labs Jul 12, 2026 7/10
skill GitHub

Vibe Coding Playbook: Tested Prompts and Workflows for AI-Driven Development

Organizes AI-driven coding with tested prompts, workflows, and rules to maintain code quality and manage complexity in fast-paced projects. Provides a structured playbook for vibe coding that prevents quality drift.

skillworkflowvibe-codingpromptsquality
by osborneomuya Jul 12, 2026 6/10
skill GitHub

Repo Docs Skills: Living Project Docs That Update as the Repo Evolves

Maintains living project docs for coding agents including guides, progress logs, change maps, and handoff context that stay updated as the repository evolves. Treats documentation as a first-class citizen that agents actively maintain.

skilldocumentationliving-docshandoffcontext
by YurunChen Jul 12, 2026 6/10
skill GitHub

AI Rulez: Complete AI Development Workflow for 19+ Tools

Complete AI development workflow supporting 19+ tools with built-in rules, agents, and conventions out of the box. Generates native configs for Claude, Cursor, Copilot, Windsurf, Gemini, Codex, and more from a single source of truth.

skillworkflowmulti-toolconfigconventionscodexcursor
by Goldziher Jul 12, 2026 7/10
skill GitHub

Claude Obsidian Memory: Two-Way Sync Claude Code Memory into Obsidian

Two-way sync between a repo's Claude Code memory and an Obsidian vault — per-fact notes, a Bases dashboard, cross-linking, and compaction. Makes Claude Code memory browsable and editable in Obsidian.

memoryobsidiansyncskillknowledge
by mikessh Jul 12, 2026 7/10
skill GitHub

CoalHearth: Session Warm-Resume and Advisory Budget Guardrail

Journals every step of a Claude Code session so interrupted sessions resume instead of rebuilding from scratch. Also provides an advisory budget guardrail to reduce limit-hit damage — without preventing it entirely.

skillresumebudgetguardrailjournalsession
by TheColliery Jul 12, 2026 7/10
skill GitHub

CoalMine: Nine Quality-Canary Skills for AI Coding Agents

Nine quality-canary skills for AI coding agents covering code health, grounding, supply chain, resilience, drift, and more. Cross-agent, consent-gated, and token-lean — designed as lightweight continuous quality checks.

skillqualitygroundingsupply-chainhealth-check
by HetCreep Jul 12, 2026 7/10
skill GitHub

Claude Code Skills: Standardized SDLC Workflows for Claude Code

Automates the software development lifecycle for Claude Code with standardized workflows, project scaffolding, session management, and diagnostic audits. Provides a cohesive skill pack covering the full development cycle.

skillsdlcworkflowscaffoldsession
by dressingcasewildcat6783 Jul 12, 2026 6/10
skill GitHub

Context Optimizer: Reduce Claude Token Consumption with Local Manifests

Reduces Claude token consumption by using local manifests to index and summarize project files for efficient context management. Maintains a lightweight file map so agents load only relevant context rather than whole codebases.

skillcontexttokensoptimizationmanifest
by aaron4605 Jul 12, 2026 6/10
skill GitHub

Memctx: Persistent Session Memory and Context Handoff for Claude Code

Manages persistent session memory and context handoff for Claude Code to maintain continuity between tasks. Provides a lightweight memory layer that survives session ends and carries forward task state.

skillmemorycontexthandoffcontinuity
by allans4635 Jul 12, 2026 6/10
skill GitHub

BGGG Skill Taotie: Evolve AI Skills Through Comparative Testing

Analyzes and evolves AI skills through comparative testing, pattern extraction, and iterative refinement to improve agent performance. Meta-skill for improving other skills by benchmarking their outputs.

skillmetaimprovementtestingrefinement
by Einherjar99 Jul 12, 2026 6/10
skill GitHub

Web Perf Audit: Claude Skill for Automated Core Web Vitals Audits

A Claude Skill that automates web performance audits (LCP, CLS, INP) using web.dev guidelines, delivering structured reports, actionable fix scripts, and incremental analysis. Turns Claude Code into a web performance specialist.

skillperformanceweb-vitalsauditlcpcls
by EVEDensity Jul 12, 2026 6/10
skill GitHub

Somtum: Local-First Memory and Prompt-Cache Layer for Claude Code

Local-first memory and prompt-cache layer for Claude Code that persists context between sessions without external dependencies. Designed as a lightweight caching layer that reduces repeated context loading.

skillmemorycachelocal-firstcontext
by riz007 Jul 12, 2026 6/10
skill GitHub

Rashinban: Turn Rough Agent Requests into Linted, Verifiable Goals

A compass for autonomous agent goals — turns a rough request into a linted, verifiable /goal. Harness-engineered derivative of goal-setter that enforces clarity and measurability before an agent begins work.

skillgoalsplanningverificationclarity
by kubouchiyuya Jul 12, 2026 6/10
skill GitHub

Awesome Claude Design: DESIGN.md Files for UI Project Scaffolding

Scaffolds full UI projects using ready-to-use DESIGN.md files and Claude Design integration. Provides opinionated starting points for design-first development with AI coding agents.

skilldesignuiscaffolddesign-md
by alfonsosagacious5877 Jul 12, 2026 6/10
skill Reddit

Hook-Driven Memory Plugin Evolved from Simple Markdown Files

A session memory and workflow plugin that evolved from basic markdown files into a hook-driven system — context injected at the right moment, task backlog that survives sessions, and a workflow layer (brief→plan→build→verify→ship→learn). Hooks fire silently on failure so sessions are never blocked.

skillmemoryhooksworkflowmarkdownsession
by too_lazy--- Jul 12, 2026 7/10
skill GitHub

Flatten MCP: Losslessly Cut Claude Code Session Context Tokens

Cuts a Claude Code session's context tokens losslessly — bulky tool output moves to a local backup while every prompt stays verbatim and the session resumes lighter. The reversible alternative to /compact with no information loss.

skillcontexttokensmcpcompactlossless
by shayaShav Jul 12, 2026 7/10
skill GitHub

Boffin: Portable Architectural Guardrails for AI Coding Agents

Portable architectural guardrails for AI coding agents that enforce structural constraints across sessions. Provides CLAUDE.md-compatible rules that prevent agents from violating architectural patterns.

skillguardrailsarchitectureconstraintsportable
by MicSm Jul 12, 2026 6/10
skill GitHub

AI SecondBrain Stack: Git-Versioned Second Brain for AI Coding Agents

Git-versioned second brain for AI coding agents (Claude Code, Codex, Gemini CLI, OpenCode) with one rulebook and the agent as the installer. Keeps shared knowledge versioned alongside the codebase.

skillmemorygitknowledgemulti-agent
by natscho-hh Jul 12, 2026 6/10
skill GitHub

SuperSEO Skills: 11 Claude Skills for SEO Audits and Content Strategy

A collection of 11 production-tested Claude skills that automate SEO audits, content briefs, and strategy planning using AI-driven research without external data input. Designed for drop-in use in any skills-compatible agent.

skillseocontentautomation
by flakey-caster542 Jul 12, 2026 5/10
skill GitHub

Scientific Thinking Skill: Structured Reasoning for AI Agents

Applies structured scientific reasoning to AI agents — decomposing questions, verifying claim provenance, and ranking explanations by evidence strength. Helps agents approach problems more rigorously by following scientific methodology.

reasoningskillscientificepistemics
by felipedeso7za4444 Jul 12, 2026 6/10
skill GitHub

BigQuery Expert: Claude Code Skill for Automated BigQuery Tasks

Claude Code plugin that automates BigQuery tasks including SQL generation, cost optimization, schema design, and anti-pattern detection. Useful for data engineers who want AI-assisted BigQuery work directly in their agent.

bigquerysqldataskillgoogle-cloud
by Ocean1346 Jul 12, 2026 6/10
skill GitHub

Paper-Fetch: Download Scientific Papers from DOI with Fallback Chain

Downloads scientific papers automatically from DOI inputs using a six-source fallback chain with zero dependencies. Useful for research agents that need to retrieve academic papers programmatically.

researchpapersdoiskillacademic
by Kara-lynnmacroeconomic2412 Jul 12, 2026 6/10
skill GitHub

Hane: Reusable Claude Code Skills for PR Workflow and Doc Maintenance

A set of reusable Claude Code skills for branch/worktree-based PR workflows, design documents, acceptance tests, and documentation maintenance. Provides a structured git workflow skill pack for teams using Claude Code.

skillprworkflowworktreedocsgit
by kompiro Jul 12, 2026 7/10
skill Reddit

Temporal Debug Skill: Debug Historical Bugs with Git Worktrees

Solves the "debugging the past" problem: when an agent gets an old crash log, this skill resolves the historical commit hash, spins up an isolated git worktree at that exact moment, analyzes the old code for root cause, then removes the worktree — keeping the local workspace untouched. Prevents agents from detached HEAD accidents during historical debugging.

debugginggitworktreeskillhistory
by Puzzled_Camera_7805 Jul 12, 2026 8/10
skill GitHub

SWE Workbench: Senior Engineer Toolkit for Claude Code

Claude Code plugin providing a senior-engineer toolkit with Clean Architecture, DDD, SOLID, TDD, design patterns, and expertise across Go/Rust/TypeScript. Includes a full development lifecycle skill backed by engineering best practices.

skillarchitecturebest-practicesengineeringtdd
by lugassawan Jul 12, 2026 6/10
skill GitHub

Alex ACT Edition: Critical Thinking Brain Template for AI Coding Agents

ACT-Edition brain template for AI coding assistants with critical thinking, epistemic calibration, and structured reasoning. Provides a CLAUDE.md-compatible configuration that instills more careful, self-questioning behavior in agents.

skillbrainreasoningclaude-mdcalibration
by fabioc-aloha Jul 12, 2026 6/10
skill GitHub

Memory Playbook: Self-Governing Memory Skill for Claude Code

A Claude Code skill that keeps memory tidy by never bloating, avoiding repeated bug fixes, and monitoring its own rules for contradictions. Implements self-policing memory management with constraints on what gets stored and when to compact.

memoryskillcontextself-governance
by itsmynamee Jul 12, 2026 7/10
skill GitHub

Agent Skills: Curated Practical Skills for Coding Agents

A curated collection of practical, evidence-backed skills for coding agents covering common development tasks. Emphasizes real-world tested patterns rather than theoretical or experimental approaches.

skillcuratedcoding
by zacharygcook Jul 12, 2026 6/10
skill GitHub

Init-Configurator: Agentic Project Bootstrap with Verification CLI

Provides an agentic project base where Claude Code skills bootstrap and evolve your project, with a deterministic Python CLI that verifies the result. Uses a project.yaml manifest, doctor checks, and path linting as an alternative to traditional project templates.

skillbootstrapprojectverificationscaffold
by Stepkar2004 Jul 12, 2026 6/10
skill GitHub

ai-gtm-skill-library: 31 GTM Skills for Claude Code Across the Revenue Lifecycle

A library of 31 opinionated go-to-market skills for Claude Code and GitHub Copilot, spanning the full revenue lifecycle: discover, design, position, amplify, launch, optimize, and RevOps. Each skill encodes GTM methodology as a reusable Claude Code skill.

skillsgtmsalesmarketingrevenue
by varunk130 Jul 11, 2026 6/10
skill GitHub

claude-code-skills: 29 Production-Grade Skills for Finance, Product, and Strategy

A curated library of 29 production-grade Claude Code custom skills categorized across finance, product management, strategy, game theory, and document processing. Focused on business-domain expertise rather than generic coding tasks, with each skill designed for real workflows.

skillsfinanceproductstrategybusiness
by varunk130 Jul 11, 2026 8/10
skill GitHub

Practical Agent Skills for Repeatable Workflows and Business Context

A collection of practical agent skills built for repeatable workflows and durable product or business context. Focused on Claude Code users who need skills that encode real-world business logic rather than generic coding tasks.

skillsworkflowsbusinessproduct
by manansuneja Jul 11, 2026 6/10
skill GitHub

claude-cast: 70 AI Personality Agents for Claude Code

Adds 70 AI personality agents to Claude Code that deliver coding advice through character-based interactions. Each personality maintains accuracy while adding an entertaining style, giving you a range of personas for different coding contexts.

personalityskillsagentscustomization
by psuneeltej3591 Jul 11, 2026 5/10
skill GitHub

claude-skills: Portable Skills, Agents, and Rules with CLI Installer

A collection of portable Claude Code skills, agents, and rules that can be installed across machines via a single CLI command. Solves the problem of keeping consistent skill setups across different environments without manual file copying.

skillsportabilitycliagents
by arghhhhh Jul 11, 2026 8/10
skill GitHub

LORM: Layered Operational Responsibility Model — L0-L5 Autonomy Levels for Claude Code

A formal trust architecture defining six autonomy levels (L0-L5) for AI agents, each graded by authorization source with a lifecycle for trust promotion and demotion. Includes a Claude Code plugin with an agent skill and policy-driven enforcement hooks to operationalize the spec in real workflows.

autonomytrustpermissionshooksgovernance
by Argyronix Jul 11, 2026 7/10
skill GitHub

context-pack: Version-Aware Context Packs for Claude, Codex, and Cursor

Structured context packs that are versioned and aware of differences across coding agents, supporting Codex, Claude, Cursor, and others. Provides a consistent way to maintain and distribute up-to-date context configuration across different AI coding tools.

contextclaude.mdcompatibilityversioning
by Fharena Jul 11, 2026 5/10
skill GitHub

vp-claude: Claude Code Plugin Marketplace with Basic Memory-to-Knowledge-Graph Plugin

A Claude Code plugin marketplace that includes a plugin converting Basic Memory into an actively maintained, interconnected knowledge graph. Helps structure and query persistent memory across sessions with richer relationships than flat note storage.

memoryknowledge-graphplugin-marketplacebasic-memory
by voxpelli Jul 11, 2026 7/10
skill GitHub

claude-skills: Full Website Lifecycle Skills for Claude Code — Brand, SEO, Dev, Ops, and Growth

A stack-agnostic collection of Claude Skills covering the full website development lifecycle: brand and design, content creation, SEO, development, operations, growth, and research. Provides a coherent, integrated skill suite for building, shipping, auditing, and optimizing websites entirely through Claude Code.

skillswebsiteseobrandoperationsgrowth
by rampstackco Jul 11, 2026 6/10
skill GitHub

Two-Phase Academic Paper Proofreading Skill for Claude Code

A Claude Code skill that proofreads academic papers in two phases: first detecting writing issues with numbered, organized feedback, then applying fixes. Uses both Claude Code and Codex to catch grammar, clarity, and structure problems in research writing.

skillwritingproofreadingacademiclatex
by reviewtaipei284 Jul 11, 2026 6/10
skill GitHub

Slobac: Agent Skill to Audit and Refactor Test Suites

A skill and accompanying manifesto for detecting test smells and safely refactoring test suites. It identifies common test anti-patterns (duplication, unclear assertions, brittle fixtures) and proposes targeted refactors. Includes documented principles for what makes a test suite healthy.

skilltestingrefactoringtest-smellsquality
by Texarkanine Jul 11, 2026 6/10
skill Reddit

Fable 5 made a Fireship Video for GPT 5.6 Sol

Had some fable usage to waste yesterday cause my reset was gonna happen. Ended up burning all my usage so had to finish the last part with Sol itself. Imo Remotion based videos feel better to watch...

api
by mesmerlord Jul 11, 2026 5/10
skill Reddit

Bundled "verify" skill consumed all tokens

I am not sure if this is a bug, but it never did it before. I asked a super simple task (add version number to the botton of the screen) and went on playing Doom, next time I checked on it - 100% l...

skill
by ParticularAnt5424 Jul 11, 2026 5/10
skill GitHub

skill: 收录最全、更新最快的技能Skills 商店,涵盖文档处理、内容创作、编程开发、机器学习、自动化工作流等多个领域的 72 个精选技能包。所有技能已打

收录最全、更新最快的技能Skills 商店,涵盖文档处理、内容创作、编程开发、机器学习、自动化工作流等多个领域的 72 个精选技能包。所有技能已打包完成,可直接安装使用! 该商店中自动抓取了 Github 上的所有的 Skills 项目,并按照分类、更新时间、Star 数量等标签进行整理。

skillgit
by anbeime Jul 11, 2026 5/10
skill Reddit

Generative Media Skills for Claude Code

https://github.com/calesthio/generative-media-skills Try if this is useful for you submitted by /u/Responsible_Maybe875 [link] [comments]

skillgit
by Responsible_Maybe875 Jul 11, 2026 8/10
skill GitHub

lore: Framework-Agnostic Project Memory Skill for AI Coding Agents

Provides framework-agnostic project memory for agents — preserving architecture, decisions, and conventions across sessions. No database, no server, pure Markdown.

memoryproject-contextarchitecturedecisionsmarkdownskill
by TheaDust Jul 11, 2026 7/10
skill GitHub

better-thinking: Move Beyond 'think hard' for Claude

A structured approach to invoke deeper reasoning in Claude, going beyond simple 'think hard' prompts with a skill that activates more structured deliberation.

thinkingreasoningpromptingskill
by skyf0xx Jul 11, 2026 7/10
skill GitHub

toolshed: Reference Docs as Checkable Claims for Claude Code

A Claude Code plugin covering the full documentation lifecycle: bootstrap → write → detect drift → fix. Turns docs into verifiable claims the agent can check against the codebase.

documentationdrift-detectionpluginverificationlifecycle
by aj604 Jul 11, 2026 7/10
skill GitHub

hivemind: Turn Agent Traces Into Reusable Skills (activeloopai)

Converts traces from Claude Code and other agents into reusable skills that can be shared and replayed across agents. Distills learned behaviors automatically.

skillstracesreusabledistillationautomation
by activeloopai Jul 11, 2026 7/10
skill Reddit

keep-the-why: Open-Source Skill for Preserving Code Rationale Across Sessions

Teaches coding agents four workflows: capture rationale during development, recover it retrospectively, analyze before interviewing maintainers, and maintain living project context. Rationale is classified as confirmed/inferred/unknown — agents must never invent project history.

skillrationalecontextdocumentationknowledge-preservation
by oliver-zehentleitner Jul 11, 2026 8/10
skill Reddit

Agent Ledger: Skill That Forces Agents to Show Their Work Before Saying Done

Requires the agent to write down the goal and scope before touching files, run checks after the task, and classify results as PASS/WARN/BLOCK. Leaves an HTML replay and structured findings in .agent-ledger/ for human and agent review.

skillverificationauditscopeaccountability
by ErProff Jul 11, 2026 8/10
skill GitHub

kitbash: Package Manager and Compiler for AI Agent Skills

Write skills once, run them in Claude Code, Cursor, Codex, Copilot, Gemini CLI, and more. A cross-harness package manager that compiles and distributes agent skills.

skillspackage-managercross-platformcodexcursor
by singhharsh1708 Jul 11, 2026 8/10
skill GitHub

principle-deepdive-html-style: Skill to Generate Self-Contained Analytical HTML Articles

A reusable skill for AI coding agents that generates single-file analytical HTML articles with built-in dark mode, responsive layouts, and zero external dependencies. The skill produces standalone files that work without a build system, making it easy to share research or documentation as self-contained pages. Targeted at agents that need to output structured reports.

skillhtmldocumentationreportsdark-modeself-contained
by studious-mantle460 Jul 10, 2026 5/10
skill GitHub

microsoft-style-skill: Audit and Rewrite Docs to Match Microsoft Writing Style Guide

A Claude Code skill that reviews technical documentation against the Microsoft Writing Style Guide and rewrites non-compliant sections. Useful for teams shipping public-facing developer docs who want consistent, professional tone without manually consulting the guide. Drop-in skill for documentation review workflows.

skilldocumentationwritingstyle-guidemicrosoft
by kongma1891 Jul 10, 2026 6/10
skill GitHub

claude-skills: PDF Extraction, Anki Flashcard Generation, and Revision Notes as Claude Skills

A small collection of Claude Agentic Skills covering PDF content extraction, automatic Anki flashcard generation, and revision note creation. Good starting point for study and knowledge management workflows within Claude Code. Each skill is composable and can be triggered via slash commands.

skillpdfankiflashcardsnotesstudy
by maaarcooo Jul 10, 2026 6/10
skill GitHub

AI-Canon: Sync One Trusted Agent Config Across All Repositories

A tool for syncing a single trusted AI-agent configuration—skills, rules, MCP servers, and scripts—across multiple repositories and coding agents. Ensures consistent behavior and prevents config drift when working across many projects simultaneously.

skillssyncmulti-repoMCPconfiguration
by lucastraba Jul 10, 2026 6/10
skill GitHub

Vibe-Check: PM-Designed Skill to Take a Vague Idea to a Buildable Plan

A Claude Code skill by a 12-year product manager for taking non-engineers from a vague idea to a buildable plan. Guides through GitHub basics, clean-code habits, a verify-and-iterate loop, and a project checkup. Contrasts with the developer-targeted grill-me skill — this one is for everyone else.

planningskillbeginnersproduct-managementworkflow
by TexasBedouin Jul 10, 2026 6/10
skill GitHub

Fintech Roast: Adversarial Code Review Plugin for Financial Code

A Claude Code plugin with a sourced rulebook that takes an adversarial approach to reviewing code touching money. Designed to catch bugs, edge cases, and compliance issues in financial code paths by roasting them rather than gently suggesting improvements.

fintechsecuritycode-reviewpluginfinance
by DylanMerigaud Jul 10, 2026 6/10
skill GitHub

Senior-Level UX Design-System Skills for AI Agents

A skill set packaging senior-level UX and design-system expertise so AI agents apply it automatically during development. Covers component design, design-system conventions, and accessibility without manual prompting per task.

UXdesign-systemskillsUIaccessibility
by dembrandt Jul 10, 2026 5/10
skill GitHub

Context-to-Action Skills: Turn Messy Business Context into Clear Decisions

Claude skills for structuring messy business context into clear asks, decisions, owners, updates, and follow-ups. Extends Claude Code's usefulness beyond pure coding into business process facilitation and meeting/communication management.

skillsbusinessdecisionsworkflowproductivity
by tmusser Jul 10, 2026 5/10
skill GitHub

Zygote: Claude Code Skill to Scaffold Backend/Frontend Boilerplates on Command

A Claude Code skill that scaffolds backend and frontend boilerplates on command, covering Sanic, FastAPI, Express, Express-MVC, React+Vite, and MERN stacks. Checks dependencies, confirms before installing, scaffolds the project structure, and sets up the local environment.

scaffoldingboilerplateskillFastAPIReactExpress
by ABaliyan31 Jul 10, 2026 6/10
skill GitHub

Pixel Surgeon: Design Craft Skill with 504 Practices for Claude Code

A design craft skill for Claude Code modeled on 16 years of product design expertise. Reviews UI, cites a specific design rule per finding, and proposes numbered fixes. Backed by a library of 504 design practices covering layout, typography, color, and interaction.

designUIUXskillscode-review
by AnimaEcho Jul 10, 2026 6/10
skill GitHub

AI Skills Mapper: Find and Eliminate Overlapping Prompts Across Agents

A Claude Code skill that maps all your local AI prompts and skills across Claude, Cursor, ChatGPT, or any folder, detects functional overlaps, and helps you decide what to consolidate or delete. Useful for cleaning up a bloated skill collection spanning multiple agents.

skillsorganizationdeduplicationmanagementprompts
by yyy805 Jul 10, 2026 6/10
skill Reddit

Claude Code Starter Pack: Vision-Locked Project Scaffolding

A scaffolding skill that creates CLAUDE.md, a read-only vision.md (chmod 444 + pre-commit hook), architecture.md, a decision ledger, session log, and append-only errors.jsonl. Keeps AI agents from re-litigating settled decisions and quietly rewriting your north-star intent across sessions.

CLAUDE.mdscaffoldingstarterproject-structurehooks
by The___Storyteller Jul 10, 2026 8/10
skill GitHub

CMS Cultivator: Claude Code Plugin for Drupal and WordPress Development

A comprehensive Claude Code plugin providing specialized slash commands for Drupal and WordPress development. Offers CMS-specific guidance to keep agents aligned with Drupal/WordPress conventions and best practices.

DrupalWordPressCMSpluginslash-commands
by kanopi Jul 10, 2026 6/10
skill GitHub

Wafflestack: Write Once, Deploy Skills Across Claude Code, Codex, and Agents

A templating tool that renders one set of reusable AI agent and skill definitions into harness-native files for .claude/, .codex/, and .agents/ directories. Eliminates the need to maintain separate skill definitions per coding agent when working across multiple platforms.

skillscross-agenttemplatesworkflowautomation
by dustinkeeton Jul 10, 2026 6/10
skill GitHub

94 Specialist Blender Skills for Claude Code with MCP Production Pipeline

A comprehensive set of 94 specialist Blender skills for use with Claude Code, Cursor, Kiro, and Codex. Covers a full MCP-powered production pipeline from blockout to game engine export, targeting Blender artists who want AI assistance in their existing workflow.

Blender3DMCPskillsgame-development
by arjun988 Jul 10, 2026 7/10
skill GitHub

Odoo AI Skills: Ground-Truth-First Development for Odoo 17/18/19

Claude Code skills for AI-driven Odoo development that read ground truth from the running instance (fields, MRO chains, views, security) before writing any code. Builds the smallest correct change, proves it with a test, and reviews before merge — never guessing from outdated docs.

OdooERPskillsPythontesting
by tuanle96 Jul 10, 2026 6/10
skill GitHub

Build-Ready: Red-Team Your Spec Before Writing Any Code

An agent skill that scores a plan or spec's autonomous-build readiness before any code exists. Evaluates the spec from a zero-context builder's seat, surfacing ambiguities and gaps that would cause an agent to stall or go wrong. Works in both Claude Code and opencode.

planningspecred-teamingpre-buildskill
by jovylle Jul 10, 2026 7/10
skill GitHub

ralvaskills: Personal Claude Code Skills Enforcing Clean Architecture

A growing personal collection of AI skills for OpenCode and Claude Code that enforces strict clean architecture and professional development standards. Serves as a template for organizing opinionated skill collections.

skillsclean-architectureOpenCodestandards
by ralvarezdev Jul 10, 2026 5/10
skill GitHub

Live Workshop Skill: Audio Transcription to Searchable JupyterBook

A Claude Code skill for building live workshop journals with audio transcription and keyword extraction. Outputs a searchable JupyterBook knowledge base from workshop sessions, making captured learning immediately navigable.

workshopaudiotranscriptionJupyterBookknowledge-base
by janineagu4049 Jul 10, 2026 5/10
skill GitHub

God-Prompt: One File to Turn AI into a Production-Grade Coding Assistant

A single prompt file that improves AI coding assistant behavior by enforcing better verification, structured workflows, and code quality standards. Drop it into any project to upgrade how Claude Code approaches tasks without extensive CLAUDE.md configuration.

CLAUDE.mdpromptworkflowcode-quality
by Heartbreaking-greenhouseeffect508 Jul 10, 2026 5/10
skill GitHub

Reusable Claude Code Skills: PR Review, Security Audits, Dependency Checks

A collection of reusable Claude Code skills covering pull-request review, security auditing, and dependency analysis. Designed to save time on recurring engineering tasks by providing repeatable, high-quality skill definitions.

skillsPR-reviewsecuritydependencies
by nariatrip191 Jul 10, 2026 5/10
skill GitHub

Teamwork: Evidence-First Skills for Claude Code, Codex, and Cursor

A set of evidence-first skills covering research, debugging, planning, execution, review, and goal loops. Compatible with Claude Code, Codex, and Cursor for cross-agent flexibility.

skillsresearchdebuggingplanningcross-agent
by JinPLu Jul 10, 2026 5/10
skill GitHub

Opus-Pack: Dense Operating Skills with Executable Gates for Claude

Distilled operating skills for daily-driver Claude models: dense rules with executable gates instead of long prose. Designed to maximize signal-to-noise in system prompts and CLAUDE.md configurations.

skillsoperating-rulesCLAUDE.mdoptimization
by F-e-u-e-r Jul 10, 2026 5/10
skill Reddit

Are one-person billion-dollar companies actually possible?

Anthropic’s CEO, Dario Amodei, recently said that we’re on track to see a billion‑dollar company run by one person using AI but that it hasn’t happened yet and that there are already two‑person AI ...

review
by sibraan_ Jul 10, 2026 6/10
skill GitHub

math-modeling-skill: 数学建模技能 - 为CUMCM、MCM/ICM等数学建模竞赛提供结构化的三阶段工作流程:建模分析、代码实现、论文撰写。

数学建模技能 - 为CUMCM、MCM/ICM等数学建模竞赛提供结构化的三阶段工作流程:建模分析、代码实现、论文撰写。包含丰富的算法资源库(优化/预测/评价/图论/机器学习等)、角色指导文档、论文模板和实用工具脚本。

skill
by XiaoMaColtAI Jul 10, 2026 5/10
skill Reddit

Consulting use cases for Claude Code and Cowork

Strategy consultants out there: what and how do you use Claude, especially Code, Cowork and Skills for your daily work? See alot of input on this sub from developers and I know finance is starting ...

skill
by Jobuno Jul 10, 2026 8/10
skill GitHub

Card_Radar: 在你手上每一張卡裡,即時挑出回饋最高的那張——CardRadar 是一個讀取 Notion 信用卡回饋規則、依「實拿金額」而非帳面利率排

在你手上每一張卡裡,即時挑出回饋最高的那張——CardRadar 是一個讀取 Notion 信用卡回饋規則、依「實拿金額」而非帳面利率排名的 Claude Skill。 · A Claude Skill that picks the highest-earning card in your wallet: it reads your credit-card rules from Notion...

skill
by kau10082 Jul 10, 2026 6/10
skill Reddit

Complete and utter waste of money and time

My use case is software engineering. I’ve been a heavy Claude user for well over a year now, and since Opus 4.7 and the “comeback” of Fable 5, I can no longer trust Anthropic models to complete the...

skillapiclaude.md
by cbl_lbc Jul 10, 2026 10/10
skill Reddit

How are you combining Claude Code with Codex?

I see a lot of people saying they subscribe and use both at once. Does anyone want to share their harness setup? Do you just use the Claude Code UI and write a skill that encourages it to delegate ...

skill
by UglyChihuahua Jul 10, 2026 10/10
skill Reddit

WTF is Cloud Agents?

I've been mainly using Claude Code over telegram with their plugin. Over time I realized how much more autonomy I want with Claude Code, or any other harness. I want it to review my pre automatical...

skillautomationreview
by sapoepsilon Jul 10, 2026 9/10
skill GitHub

mba: 把品牌影响力拆成可打分、可比较、可复盘的事。Claude Code skill,5 位人物评委(傅盛·Steve Jobs·李可佳·吴俊东·张一鸣)按

把品牌影响力拆成可打分、可比较、可复盘的事。Claude Code skill,5 位人物评委(傅盛·Steve Jobs·李可佳·吴俊东·张一鸣)按 7 维度 × 5 镜头独立打分,Lead 合成版本化报告:雷达图 + 异议热力图 + 影响力构造图 + 90 天行动建议。`/mba <brand>` 一行触发,EVOLUTION 模式追踪同一品牌随时间演化。

skill
by zhanglunet Jul 10, 2026 8/10
skill GitHub

vb-winforms-toolkit: Claude Code Skills for Modernizing VB.NET WinForms on .NET 9

A set of Claude Code skills targeting VB.NET WinForms modernization to .NET 9 in 2026. Provides guided assistance for migration tasks specific to legacy Windows desktop applications. Useful for teams maintaining older VB.NET codebases who want AI-assisted upgrade paths.

skillvb.netwinformsdotnetmigrationlegacy
by yngbrll Jul 9, 2026 5/10
skill GitHub

dotclaude: Reusable Claude Code Extension Registry

A curated registry of Claude Code extensions — skills, subagents, slash commands, and hooks — covering engineering, git, testing, and security workflows. Distributed both as a shadcn-style GitHub registry and as installable plugins, making it easy to browse and add individual extensions to any project. A well-organized starting point for building out a Claude Code toolkit.

skillssubagentsslash-commandshooksregistryextensionsgittestingsecurity
by KhaledSaeed18 Jul 9, 2026 8/10
skill Reddit

What’s your ideal Claude Code workflow setup?

I’ve seen a lot of people sharing different Claude Code setups on X, especially around CLAUDE.md files, context files, hooks, agents, and skills. My current setup is pretty simple: I keep CLAUDE.md...

skillhookworkflowclaude.md
by SevereNecessary8381 Jul 9, 2026 10/10
skill GitHub

ai-skills:

ai-skills:

skill
by rjvim Jul 9, 2026 5/10
skill Reddit

I've built a claude skill to break things only once

So the thing is I work on a team of 3-4 devs, and whenever someone's AI agent screwed something up, they'd have to just... tell the rest of us. Manually. In slack or discord. That's the entire syst...

skillgitreview
by Calm_Sandwich069 Jul 9, 2026 9/10
skill Reddit

Ideas for hooks or extra customisations

I use Claude code regularly in my job. I’m a software engineer, but it’s really good out of the box and I’m wondering what people are using hooks for or is there any other customisations I should d...

skillhookworkflow
by Ovisty Jul 9, 2026 10/10
skill Reddit

Context Governance: Making AI Context Authoritative and Precise

Context accuracy — not capacity — is the real failure mode in long-lived AI coding projects. This open-source framework defines artifact ownership, marks docs as active vs historical, and routes tasks through explicit stages to prevent the agent acting on the wrong document. Reduces debug loops and keeps design docs aligned with implementation.

context-managementCLAUDE.mdarchitectureworkflow
by feather812002finland Jul 8, 2026 6/10
skill Reddit

claude-worktrace: Auto-Capture Session Summaries and Corrections

Three skills that hook into Claude Code to automatically generate narrative work summaries on /compact, /clear, or session end. Builds a daily worklog from transcripts for standups, weekly updates, and session analysis — capturing what was decided and why, not just what files changed.

skillssession-memoryworkloghooks
by shaun_the_mehh Jul 8, 2026 7/10
skill GitHub

AGENTS.md Generator: Safe CLI for Agent Instruction Files

A safe-by-default CLI that generates and updates AGENTS.md and RUNBOOK.md for AI coding agents. Uses marker-based patches and a diff-first workflow so updates are reviewable before applying, with conservative repo auto-detection.

AGENTS.mdCLIworkflowsetup
by markoblogo Jul 8, 2026 6/10
skill GitHub

Ecommerce CRO Engine for Claude Code

A Claude Code skill that audits and optimizes ecommerce pages using research-backed conversion psychology principles. Provides structured analysis and recommendations based on CRO best practices.

ecommerceCROskilloptimization
by Dannytownkins Jul 8, 2026 5/10
skill GitHub

ReAct Deep Search Skill: Iterative Research That Follows Leads

A Claude Code skill implementing ReAct-style deep search that follows leads between rounds rather than doing broad parallel searches. Each search round builds on findings from the previous one for deeper, more targeted research.

researchskillReActsearch
by recomby-ai Jul 8, 2026 6/10
skill GitHub

204+ Curated Claude Code Skills Organized by Dev Workflow

A curated collection of 204+ Claude Code skills organized by development phase: Plan, Build, Test, Ship. Bilingual Chinese/English. Provides a comprehensive library covering the full development lifecycle.

skillscuratedworkflowbilingual
by xcodethink Jul 8, 2026 6/10
skill GitHub

Apple Text Stack Skills for Claude Code (TextKit, NSTextView)

A Claude Code plugin providing skills for Apple's text rendering stack: TextKit, UITextView, NSTextView, attributed strings, Writing Tools, and related APIs. Useful for iOS/macOS developers working on text-heavy features.

AppleiOSmacOSTextKitskill
by sitapix Jul 8, 2026 5/10
skill GitHub

xstitch: Cross-Tool Memory for Claude Code, Cursor, Codex, and 9+ Agents

Zero-dependency cross-agent memory that stitches context across Claude Code, Cursor, Codex, Gemini CLI, Windsurf, and more. Preserves decisions, failed experiments, and warnings across sessions using BM25 relevance search and MCP + instruction files.

memorycross-toolBM25MCP
by raghavvbiyani Jul 8, 2026 7/10
skill GitHub

Claude Code Field Guide: Best Practices, Skills, Plugins, and MCPs

A personal collection of battle-tested best practices, favorite skills, plugins, tools, and MCP servers for Claude Code. Well-organized reference for practitioners looking to level up their workflow.

best-practicesskillsMCPsreference
by lawwu Jul 8, 2026 6/10
skill GitHub

Awesome CLAUDE.md: 20 Best Practice Templates, Bilingual

A curated collection of 20 CLAUDE.md templates covering best practices for Claude Code project configuration. Bilingual Chinese/English, providing concrete starting points for different project types and team setups.

CLAUDE.mdtemplatesbest-practicesconfiguration
by jnMetaCode Jul 8, 2026 7/10
skill GitHub

Content Creation Skill Pack: 8 Skills with AI Slop Detector

A Claude Code skill pack for content creation with 8 skills, persistent memory, skill chaining, and a built-in AI slop detector that flags generic AI-sounding output. Designed for writers and marketers who need human-feeling results.

contentskillswritingslop-detection
by quionie Jul 8, 2026 5/10
skill GitHub

SAP Superpowers: Enforced Workflows and Checklists for Claude Code

A Claude Code configuration acting as a SAP consultant's AI operating system with enforced workflows, checklists, and hard gates. Covers SAP debugging, estimation, and go-live readiness checks.

SAPworkflowchecklistsenterprise
by vigneshbarani24 Jul 8, 2026 5/10
skill GitHub

ROS 2 Engineering Skill for Claude Code

A progressive-disclosure SKILL.md for production-grade ROS 2 development covering workspace setup, nodes, executors, QoS, ros2_control, Nav2, MoveIt 2, real-time, and deployment. Compatible with Claude Code, Codex, Cursor, and Gemini CLI.

ROS2roboticsskillembedded
by dbwls99706 Jul 8, 2026 5/10
skill Reddit

loreto.io: Extract SKILL.md Files from Documentation and Video Transcripts

A tool that ingests documentation, videos, and transcripts and outputs agent-ready SKILL.md files — not summaries, but actual skills with invocation logic, example queries, edge cases, and 'when NOT to use' guidance extracted from the source material.

skillsskill-generationdocumentationSKILL.md
by canary-black Jul 8, 2026 7/10
skill GitHub

Linux System Health Skill: OS Diagnostics for Claude Code

A Claude Code skill for diagnosing OS-level issues on Linux servers: memory, CPU, disk, network, kernel tuning, resource limits, DNS, time sync, filesystem integrity, browser deps, and locale. One command for comprehensive server health analysis.

LinuxDevOpsdiagnosticsskill
by zjxylc Jul 8, 2026 6/10
skill Reddit

Text Adventure Game Engine Skill for Claude Desktop

A skill that runs a full text adventure RPG engine inside Claude Desktop — no server needed. Supports d20, D&D 5e, GURPS Lite, Pathfinder 2e, and Shadowrun 5e with styled scenes, interactive buttons, stat panels, maps, shops, combat, and 3D dice rendered in Claude's widget system.

gamesskillRPGClaude Desktop
by gazmagik Jul 8, 2026 6/10
skill GitHub

worldbuilder: Generate Fictional Universes via Claude Code Skill

A Claude Code skill and web UI for structured worldbuilding — novels, D&D campaigns, game worlds. Runs locally, generates illustrated characters and chapter outlines, and maintains consistency across a universe through file-based structured data.

writingworldbuildingskillcreative
by gofastercloud Jul 8, 2026 5/10
skill GitHub

skillshare: Sync Agent Skills Across Claude Code, Codex, OpenClaw

A CLI tool that syncs skill files across multiple AI coding tools with one command and simplifies team sharing. Supports Claude Code, Codex, OpenClaw, and more — keeping your skills in sync everywhere.

skillssyncteammulti-agent
by runkids Jul 8, 2026 6/10
skill GitHub

Decision Orchestrator Skill: Router→Agents→CEO Workflow

A one-command skill that implements a Router→Agents→CEO decision pattern for Claude Code and OpenClaw. Routes complex decisions through specialized agents and synthesizes a final verdict from a CEO-style orchestrator.

orchestrationworkflowdecision-makingskill
by Klarinia Jul 8, 2026 6/10
skill GitHub

Declarative Agent Skills Management with Nix

A Nix module for declaratively managing Claude Code agent skills — define your skills in Nix configuration and have them deployed and versioned consistently across machines.

Nixdeclarativeskillsconfiguration
by Kyure-A Jul 8, 2026 5/10
skill GitHub

claude-replan: Validate Plans with Parallel Review Subagents

A Claude Code plugin that spawns parallel review subagents to validate implementation plans before execution — checking codebase alignment, best practices, feasibility, and blind spots. Catches issues at planning time rather than after hours of implementation.

planningvalidationsubagentspre-execution
by kojott Jul 8, 2026 8/10
skill GitHub

fallow-skills: Find Dead Code and Unused Dependencies in JS/TS

Agent skills for finding dead code, unused dependencies, and code duplication in JavaScript/TypeScript projects. Works with Claude Code, Cursor, Codex, Gemini CLI, and 30+ other agents.

JSTypeScriptdead-codecleanup
by fallow-rs Jul 8, 2026 6/10
skill Reddit

/notes Skill: Capture Ideas Mid-Session Without Breaking Focus

A Claude Code skill for capturing thoughts and ideas that arise during active debugging sessions without interrupting the current workflow. Bridges the gap between MEMORY.md (preferences), CLAUDE.md (project info), and ephemeral ideas that need to wait.

skillnotesworkflowproductivity
by mcosternl Jul 8, 2026 6/10
skill Reddit

prompt-master: Skill That Writes Accurate Prompts for Any AI Tool

A Claude skill that silently detects your target tool (Cursor, Claude Code, GPT, Midjourney, etc.) and generates accurate prompts specifically tailored to that tool's strengths and format. Built-in memory for long sessions. 1500+ GitHub stars.

prompt-engineeringskillmulti-toolproductivity
by CompetitionTrick2836 Jul 8, 2026 6/10
skill GitHub

Multi-Agent Adversarial Review Panel: 4-6 Reviewers + Supreme Judge

A Claude Code skill that spawns 4-6 AI reviewers who debate code or plans anonymously, with anti-groupthink mechanisms and 9 auto-detected signal groups — then a supreme judge delivers the final verdict. Built-in domain checklists for different review types.

code-reviewadversarialmulti-agentskill
by wan-huiyan Jul 8, 2026 8/10
skill GitHub

Curated Claude Code Skills with Evaluation Reports and Test Fixtures

A system of production-ready Claude Code skills that includes quantitative evaluation reports and golden test fixtures — not just the skills themselves, but evidence they actually work. Engineering workflow integration included.

skillsevaluationtestingproduction-ready
by johnqtcg Jul 8, 2026 7/10
skill GitHub

publish-skill: Claude Code Skill for Publishing Skills to GitHub

A meta-skill that automates publishing Claude Code skills to GitHub and awesome-claude-skills lists. Encodes lessons learned from real publishing attempts including common pitfalls and submission requirements.

skillspublishingGitHubmeta
by wan-huiyan Jul 8, 2026 5/10
skill Reddit

Roast My Skill: Get Brutal Feedback on Your SKILL.md Files

An open-source tool that roasts your SKILL.md files in-character (choose your roast persona), exposing weaknesses in your skill design. Built after discovering most skills needed significant improvement even when they 'worked'.

skillsfeedbackqualitySKILL.md
by jorkim_32 Jul 8, 2026 6/10
skill GitHub

OpenTelemetry Skills and Reference Docs for Claude Code

Official Dash0 skills and reference documentation for AI coding assistants covering OpenTelemetry instrumentation patterns, telemetry quality guides, and Dash0 integration. Helps Claude produce correct OTel code.

OpenTelemetryobservabilityskillinstrumentation
by dash0hq Jul 8, 2026 5/10
skill Reddit

Book Genesis: 20 Claude Code Skills for Autonomous Book Writing

A system of 20 specialized Claude Code skills implementing a 14-phase book pipeline from research through revision, with a Genesis Score calibrated against 15 bestsellers and 20 anti-AI patterns for human-feeling output. Produced a 68K-word memoir.

writingskillscreativeautonomous
by Turbulent_Worker9216 Jul 8, 2026 6/10
skill GitHub

React Native New Architecture Migration Skill for Claude Code

A Claude Code skill that audits bare React Native projects for New Architecture readiness — parallel library checker, JS/TS + iOS + Android native scan, Migration Effort Score, and a 4-phase migration plan. Supports monorepos, delta mode, and offline fallback.

React Nativemigrationauditskill
by rajivmanivannan Jul 8, 2026 6/10
skill GitHub

Awesome Claude Code Playbook: Battle-Tested Patterns and Configs

A curated collection of battle-tested patterns, tools, and configurations for Claude Code — covering CLAUDE.md setup, hook patterns, skill organization, and workflow automation for Anthropic's CLI coding agent.

best-practicespatternsconfigurationClaude Code
by zzhou23 Jul 8, 2026 6/10
skill GitHub

claude-blueprint: Reusable Claude Code Setup with Skills, Agents, Hooks

A personal Claude Code blueprint providing a complete reusable setup — skills, agents, hooks, and rules — shareable across all projects. Serves as a template for kickstarting new projects with a proven configuration.

blueprinttemplatehooksskills
by herbeckrobin Jul 8, 2026 5/10
skill Reddit

One Question to Distinguish Skills from Agents: Consistency vs Judgment

A clear mental model for when to use a skill vs an agent: skills execute the same steps every time (consistency), agents exercise judgment to choose different paths (decision-making). One question clears it up: does the task need consistency or judgment?

skillsagentsmental-modelworkflow
by dydolino Jul 8, 2026 7/10
skill Reddit

Restructure CLAUDE.md to Stop Burning Context Mid-Run

Traces agent failures to one root cause: CLAUDE.md grown into a wall of history that floods the context before real work starts. Solution: split CLAUDE.md into a slim project brief, separate decision log, and component-level context files loaded only when needed. Concrete before/after structure included.

CLAUDE.mdcontextlong-sessionsconfiguration
by ShellSageAI Jul 8, 2026 8/10
skill Reddit

Keeping CLAUDE.md and Context Files Fresh Across Long Projects

Strategies for preventing context drift in long-lived projects: component-level CLAUDE.md files that agents update as they work, explicit 'known good baseline' markers, and scheduled context refresh checkpoints. Addresses the grep spiral problem where Claude searches the whole codebase instead of using context.

CLAUDE.mdcontextdriftbest-practices
by hustler-econ Jul 8, 2026 7/10
skill Reddit

Stop Overengineering SKILL.md: Push vs Pull Context Loading

A practical guide to the skill authoring sweet spot: unlike CLAUDE.md (always loaded) and ad-hoc prompts (never reused), skills are pull-loaded only when the agent matches the task. Covers minimal effective file structure and when not to use a skill.

SKILL.mdbest-practicescontextskills
by AnayMehra Jul 8, 2026 7/10
skill GitHub

html-artifacts: Generate Self-Contained HTML Instead of Markdown

A skill that makes Claude output self-contained HTML artifacts for tasks instead of standard markdown, improving content rendering and enabling interactive user interfaces within Claude's response.

skillHTMLartifactsrendering
by dovydaskarbutovskis20-art Jul 8, 2026 5/10
skill GitHub

Agent-Startup-Skills: 8-Phase SaaS Pipeline with Mandatory Approval Gates

A skill set for building SaaS products through an 8-phase AI agent pipeline with mandatory human approval gates between phases. Works with Claude Code, Antigravity, and Codex. Enforces structured progression from concept to deployment.

SaaSskillsworkflowapproval-gates
by batterfried-philosophy172 Jul 8, 2026 5/10
skill GitHub

SOTA Claude Code Skills: 30 Domain Skills with BUILD/AUDIT Modes

State-of-the-art (2026) Claude Code skills for building and auditing software across 30 domains and languages, with BUILD and AUDIT modes and structured audit checklists. Covers mainstream stacks and specialized domains.

skillsauditbuildmulti-domain
by martinholovsky Jul 8, 2026 6/10
skill Reddit

Marketing Audit Suite: 15 Slash Commands and 5 Parallel Agents for Claude Code

An open-source marketing audit toolkit built with Claude Code's SKILL.md system, featuring 15 slash commands and a parallel agent architecture. Running /market audit spawns 5 specialized sub-agents simultaneously analyzing content, conversion, SEO, competitive positioning, and brand. Bilingual (FR/EN), MIT licensed, installable in 30 seconds.

skillslash-commandsparallel-agentsmarketingopen-source
by Johssinma Mar 19, 2026 7/10
skill GitHub

CLAUDE.md Config for Automated PR Planning and CodeRabbit Review Loops

A CLAUDE.md configuration that teaches Claude Code to collaborate with CodeRabbit for end-to-end PR workflows. Automates PR planning, code review loops, and merge workflows by defining how Claude Code and CodeRabbit interact. Drop-in configuration for teams already using CodeRabbit.

claude.mdcoderabbitcode-reviewpr-workflowautomation
by auerbachb Mar 19, 2026 7/10
skill Reddit

5 Free Claude Code Skills for Codebase Onboarding Documentation

A set of 5 free Claude Code slash commands for generating onboarding documentation grounded in actual repo files. Covers architecture overview, module dependency maps, environment setup, ownership maps, and more. Each skill reads the real codebase and produces a doc without hallucinated stack details.

skillsslash-commandsonboardingdocumentationcodebase
by Upbeat-Rate3345 Mar 19, 2026 7/10
skill GitHub

PDFjs-Claude-Skill-Package: 13 Deterministic Skills for PDF.js Development

A collection of 13 deterministic Claude AI skills for PDF.js (pdfjs-dist 5.x), covering rendering, viewer development, error handling, and project scaffolding. Designed to give Claude Code reliable, up-to-date context for PDF.js projects. Useful for developers building PDF viewers or document processing tools.

skillspdf.jspdfjsrenderingfrontend
by OpenAEC-Foundation Mar 19, 2026 6/10
skill GitHub

cli-code-skills: Production-Ready Skills for Code Audit, Docs, Design, and Infra

A set of production-ready Claude Code skills covering code quality auditing, design document generation, documentation automation, and infrastructure tasks. Each skill is a slash command that can be dropped into any Claude Code project. Practical and immediately usable across multiple engineering workflows.

skillscode-auditdocumentationinfrastructuredesign-docs
by Destynova2 Mar 19, 2026 7/10
skill Reddit

Loading CLAUDE.md Files Outside the Project Tree On-Demand with @-References

Claude Code normally auto-loads only CLAUDE.md files within the project hierarchy, but you can use @-references to pull in any CLAUDE.md from anywhere in the filesystem on-demand. This technique enables shared global configurations, library-specific instructions, and cross-project skill sets without polluting individual repos. Post includes concrete examples and edge cases.

claude.mdconfigurationfile-loadingtipsglobal-config
by thealliane96 Mar 19, 2026 7/10
skill Reddit

Avoiding Generic Claude Frontends: Component Library, Icon Set, and /talklikeme Skill

Practical tips for escaping the default Claude frontend look: lock it to a strong component library (with MCP if available), specify an icon library, write explicit CLAUDE.md guidelines for colors/fonts/patterns you hate, and create a /talklikeme skill trained on your own writing so copy sounds human. The /talklikeme approach involves feeding past essays and having Claude interview you to learn your voice.

frontendskilldesigntalklikemecomponent-libraryclaude.md
by Pitiful-Head-4162 Mar 19, 2026 6/10
skill GitHub

sdlc-studio: Claude Code Skill for the Full Software Development Lifecycle

A Claude Code skill that manages the complete software development lifecycle from planning through deployment. Designed as a reusable SKILL.md component to bring consistent SDLC discipline to Claude Code-driven projects.

skillsdlclifecycleworkflowskill.md
by DarrenBenson Mar 19, 2026 7/10
skill GitHub

claude-superskills: 44+ Universal Skills for Claude Code and GitHub Copilot

A collection of 44+ standardized SKILL.md files covering Solution Architecture, Startup Strategy, Software Engineering, and Product Growth — usable with both Claude Code and GitHub Copilot. Each skill targets a specific professional domain and provides structured prompting workflows across AI coding tools.

skillsskill.mdarchitecturestartupcopilotuniversal
by ericgandrade Mar 19, 2026 7/10
skill Reddit

/do Router Skill: Single Entry Point That Dispatches to the Right Skill, Agent, or Pipeline

A skill routing pattern where every Claude Code command goes through a single /do dispatcher that reads intent and routes to the correct skill, agent, or pipeline automatically. Eliminates the problem of Claude not using the right tool for each task. The SKILL.md is open-sourced as part of a broader claude-code-toolkit.

skillrouterdispatchskill.mdautomationworkflow
by AndyNemmity Mar 19, 2026 7/10
skill GitHub

skill-social-media: Write Platform-Native Posts and Plan Content

A social media content skill for AI agents that writes platform-native posts for different networks, plans content calendars, and researches hashtags. Free and open source. Good starting point for anyone building social media automation with Claude Code skills.

skillsocial-mediacontentautomationmarketing
by superlowburn Mar 19, 2026 6/10
skill GitHub

skill-lead-gen: Research Prospects and Generate Outreach via Agent

A lead generation skill for AI agents that researches prospects, scores them against an ideal customer profile (ICP), and generates outreach messages. Free and open source. Useful as a starting template for sales automation workflows using Claude Code.

skilllead-gensalesoutreachautomation
by superlowburn Mar 19, 2026 5/10
skill GitHub

skill-invoice-billing: Generate Invoices and Track Payments via Agent

An invoice and billing skill for AI agents that generates invoices, tracks payment status, and sends reminders. Free and open source. Useful template for integrating billing workflows into Claude Code-based business automation.

skillinvoicebillingpaymentsbusiness
by superlowburn Mar 19, 2026 5/10
skill GitHub

skill-customer-support: Ticket Triage and Response Drafting for Agents

A customer support triage skill for AI agents that classifies support tickets, prioritizes queues, drafts responses, and detects churn risk. Free and open source. Good foundation for building AI-powered customer support workflows with Claude Code.

skillcustomer-supporttriageticketsautomation
by superlowburn Mar 19, 2026 6/10
skill GitHub

skill-seo-audit: On-Page SEO Analysis Skill for AI Agents

An SEO audit skill for AI agents that analyzes on-page SEO factors including meta tags, headings, content quality, and internal linking. Free and open source. Good base skill for building SEO analysis and reporting into Claude Code workflows.

skillseoauditcontentanalysis
by superlowburn Mar 19, 2026 5/10
skill GitHub

frontend-landings: Generate Animated HTML Landing Pages via Skill

A Claude Code skill that generates standalone, animated HTML landing pages from just a product description — no dependencies, no build step. Produces self-contained HTML files with animations using only a short text prompt. Useful for quickly prototyping or generating marketing pages.

skillhtmllanding-pagefrontendgeneration
by hemsurendranath Mar 19, 2026 7/10
skill Reddit

Auto.dev Skill for Claude: Search Real Car Inventory and Decode VINs

An agent skill for the Auto.dev automotive data platform that gives Claude the ability to search live car inventory, decode VINs, check recalls, and calculate payments. Install with npx skills add drivly/auto-dev-skill. Shows the power of domain-specific skills for real-world data queries.

skillautomotiveapidatadomain-specific
by Masterpiece-Smart Mar 19, 2026 6/10
skill GitHub

hono-skill: Claude Code Skill for Hono Application Development

A Claude Code skill that integrates Hono CLI tools for building Hono web applications. Provides project scaffolding, routing patterns, and Hono-specific best practices directly in Claude Code sessions. Good for developers using the Hono framework who want AI-assisted development.

honoskillwebframeworkcli
by panjicopri Mar 19, 2026 5/10
skill GitHub

awesome-skills: Agent Skills for Local Workflow Automation

A collection of reusable agent skills focused on local workflows and automation, including utilities for China workday calendar checks and Codex session history tools. Good starting point for building locale-specific or developer-workflow automation skills.

skillsautomationlocalworkflowcodex
by Sube-py Mar 19, 2026 6/10
skill GitHub

n8n-Claude-Skill-Package: 21 Claude Skills for n8n Automation

21 deterministic Claude AI skills packaged for n8n v1.x workflow automation. Bridges Claude Code capabilities with n8n's visual workflow builder for non-code automation. Useful for building AI-powered automation pipelines that combine Claude reasoning with n8n integrations.

skillsn8nautomationworkflowintegration
by OpenAEC-Foundation Mar 19, 2026 8/10
skill Reddit

auto-save-and-push: Skill to Fight Context Rot with Git Checkpoints

A Claude Code skill that runs on a 30-minute loop to validate your git repo, audit file organization, flag clutter, and push a checkpoint commit. Specifically designed to counter context rot — the gradual degradation of AI response quality in long sessions. Can be triggered manually or automatically.

skillsgitcontext-rotautomationmemory
by ProjectorMusic Mar 19, 2026 7/10
skill GitHub

agent-toolkit: Reusable Skills and Plugins for Claude Code

A personal agent toolkit repository containing reusable skills and plugins for Claude Code, Cursor, Codex, and Gemini CLI. Provides a structured library of common tasks and automations so you do not have to recreate skills from scratch. A good reference for building your own skill collection.

skillspluginsreusableclaude-codetoolkit
by svyatov Mar 19, 2026 7/10
skill GitHub

claude-skills-journalism: Skills for Research, FOIA, and Verification

A set of Claude Code skills tailored for journalism, media, and academic work — covering source verification, FOIA request drafting, data journalism workflows, and academic writing. Practical skills for researchers and journalists who use Claude Code for investigative and writing tasks.

skillsjournalismresearchverificationacademia
by jamditis Mar 19, 2026 7/10
skill Reddit

Claude Code Skills That Make Agent Teammates Play Connect Four and Tic-Tac-Toe

Two Claude Code skills that spawn agent teammates and have them play games against each other — Connect Four and Tic-Tac-Toe. A fun demonstration of the agent teams feature and how skills can orchestrate multi-agent interactions beyond purely productive tasks.

skillagent-teamsgamesmulti-agent
by CygraW Mar 19, 2026 6/10
skill GitHub

Claude Code Plugin: Technical Document Review with Three-Pass Workflow

A Claude Code plugin implementing the "Three Reviews and Three Proofreads" (三审三校) technical document review workflow. Simulates a team of reviewers across three distinct review passes for accuracy, clarity, and style. Especially relevant for documentation-heavy engineering teams.

documentationreviewworkflowplugin
by ShieldBytes Mar 19, 2026 6/10
skill GitHub

Awesome CLAUDE.md: Battle-Tested Configs for Next.js, React, Python, Flutter, and More

A curated collection of battle-tested CLAUDE.md files for common stacks including Next.js, React, Python, and Flutter. Ready to drop into any project to instantly give Claude Code the right context, conventions, and guardrails for each stack. Good starting point for teams standardizing their AI configs.

claude-mdconfigurationtemplatesbest-practices
by sx4im Mar 19, 2026 7/10
skill GitHub

Agent Skills by CyperX: Write Once, Run Everywhere Skills Collection

A collection of agent skills by CyperX designed to work across different AI coding assistants. The "write once, run everywhere" philosophy means skills don't need to be adapted per platform. A useful starting point for developers building cross-compatible agent skill libraries.

skillscross-platformcollection
by cyperx84 Mar 19, 2026 5/10
skill GitHub

Claude Self-Score: Plugin That Scores Work Quality Against a 7-Dimension Rubric

A Claude Code plugin that evaluates work quality across a 7-dimension rubric before completing a task. Forces the agent to self-assess before declaring done, catching low-quality output early. The rubric covers correctness, completeness, clarity, security, performance, maintainability, and test coverage.

qualityself-assessmentrubricplugin
by augmentedivan Mar 19, 2026 7/10
skill GitHub

SkillPod: CLI for Authoring and Managing a Personal Agent Skills Registry Backed by GitHub

A CLI tool for creating, managing, and publishing a personal agent skills registry hosted on GitHub. Authors skills with a local editor, version-controls them via git, and publishes the registry for use across any agent platform. A structured alternative to manually managing .skill files.

skillsregistrycligithub
by sushil-kamble Mar 19, 2026 7/10
skill GitHub

sd0x-dev-flow: Plugin Ecosystem for Claude Code

A plugin ecosystem for Claude Code introducing the sd0x-dev-flow framework. Provides a structured set of plugins for common development flows within Claude Code sessions.

pluginecosystemworkflow
by sd0xdev Mar 19, 2026 5/10
skill GitHub

Aurakit: All-in-One Claude Code Skill with 4-Layer Security and Full Stack Operations

An all-in-one /aura slash command skill for Claude Code providing build, fix, clean, deploy, and review operations with 4-layer security verification, triple confirmation checks, and compact defense mode. Designed as a single skill that handles the full development lifecycle.

skillsecurityfull-stackslash-command
by smorky850612 Mar 19, 2026 7/10
skill GitHub

eCommerce Skills: AI Agent Skills for Amazon, Shopify, Etsy, and TikTok Shop

A collection of AI agent skills for e-commerce workflows — product research, marketing automation, supply chain optimization, and business analytics. Covers Amazon, Shopify, Etsy, TikTok Shop, and other major platforms. Aimed at solo sellers and small teams who want AI automation without custom development.

skillsecommerceautomationshopify
by nexscope-ai Mar 19, 2026 5/10
skill GitHub

Veriglow Agent Map Skill: Discover Hidden APIs and Browser Automation Recipes for Any Website

A skill that teaches AI agents to discover hidden APIs, data functions, and browser automation recipes for arbitrary websites. Works with Claude Code, ClawHub, Cursor, and any AgentSkills-compatible agent. Useful for building scrapers, automations, or integrations without documented APIs.

skillapi-discoveryautomationweb-scraping
by ChizhongWang Mar 19, 2026 6/10
skill Reddit

Building the First Claude Visual Skill with Interactive UI Blocks

A report on building and testing the first Claude Visual Skill — a skill that generates interactive UI blocks directly in the Claude chat interface using the new Visuals feature. Demonstrates the potential of combining Claude Code's skill system with the inline visual rendering API.

skillvisualsuiclaude-api
by romancone Mar 19, 2026 5/10
skill Reddit

Future Work Paradigm Designer: Claude Skill for AI-Era Job Redesign

A Claude skill that breaks any job down to granular sub-tasks, determines which parts AI should handle vs. humans, designs a multi-agent collaboration system, and generates an implementation roadmap. Tested on a real HR case with 61 sub-tasks. Free .skill file available.

skillworkflow-designautomationhr
by Significant-Bag2944 Mar 19, 2026 6/10
skill Reddit

CLAUDE.md Rule to Prevent Claude from Losing State When a Session Is Interrupted

A simple but effective CLAUDE.md rule that prevents Claude from silently reconstructing context after a session stop. Without this rule, Claude pretends to understand context it doesn't have. The rule forces explicit acknowledgment of lost state rather than confident guessing.

claude-mdsessionconfigurationbest-practices
by Valo-AI Mar 19, 2026 5/10
skill GitHub

Curated Claude Code Skills for Development Workflows with Best Practices

A curated collection of Claude Code skills focused on AI-assisted development workflows. Each skill includes structured guidance, best practices, and ready-to-use patterns for common development tasks. Designed to consistently improve Claude Code output quality across different projects.

skillsbest-practicesworkflowcollection
by mumudevx Mar 19, 2026 6/10
skill Reddit

prompt-master: Claude Skill That Writes Accurate Prompts for Any AI Tool (600+ Stars)

A free Claude skill that writes accurate, tool-specific prompts for Cursor, Claude Code, GPT, Midjourney, Kling, Eleven Labs, and other AI tools. Instead of generic prompts, it generates prompts calibrated for each tool's specific strengths. Has accumulated 600+ GitHub stars and 4000+ traffic visits.

skillprompt-engineeringmulti-toolpopular
by CompetitionTrick2836 Mar 19, 2026 8/10
skill GitHub

Tandem Marketplace: 20 Workflow Skills Plugin for Claude Code Cowork Mode

A managed AI personal assistant plugin for Claude Code Cowork mode featuring 20 workflow skills, guided onboarding, a proactive behavior engine, and multilingual support (EN/HE/RU). Provides a structured skill marketplace experience within Claude Code.

skillscoworkmultilingualmarketplace
by BinatrixAI Mar 19, 2026 7/10
skill GitHub

Cypress Agent Skill: Write, Debug, and Optimize Cypress Tests via AI Agent

A skill providing AI agents with a comprehensive knowledge base for writing, debugging, and optimizing Cypress tests. Includes standard patterns, best practices, and common pitfalls for E2E testing. Useful for teams using Claude Code in their frontend testing workflow.

testingcypresse2eskill
by YTItsfrost Mar 19, 2026 6/10
skill GitHub

Prompt Engineer Skill: Expert Prompt Engineering for Claude Code and Multi-Platform Agents

An expert-level prompt engineering skill covering system prompts, tool descriptions, context engineering, and cross-provider compatibility. Works with Claude Code, Cursor, Gemini CLI, and any Agent Skills-compatible tool. A reference implementation for prompts that work well across different AI platforms.

prompt-engineeringskillcross-platformbest-practices
by Shaharsha Mar 19, 2026 7/10
skill GitHub

Curated Claude Code Skills for Product Management and Workflow Automation

A collection of Claude Code skills focused on product management workflows and development automation. Covers common PM tasks like spec writing, roadmap planning, and stakeholder communication — filling a gap in the mostly developer-focused skills ecosystem.

skillsproduct-managementautomationworkflow
by tflaim Mar 19, 2026 6/10
skill GitHub

claude-config: Configuration Framework With Specialized Agents for Claude Code

A drop-in configuration framework that enhances Claude Code with specialized agents and workflow automations for common development tasks. Provides structured agent behaviors and workflow pipelines for efficient coding automation. Open source on GitHub.

configagentsworkflowautomationclaude-code
by Kamixon131 Mar 19, 2026 6/10
skill GitHub

The Ultimate Claude Code Toolkit: 119 Skills, 67 Agents, 30 Commands, 8 Hooks

A comprehensive drop-in ~/.claude configuration that bundles 119 skills, 67 agents, 101 marketplace repos (6,600+ community skills), 30 commands, and 8 hooks with zero configuration required. The toolkit auto-activates the right resources based on your prompt, making it a turnkey upgrade for any Claude Code setup. One of the most complete community config collections available.

skillsagentscommandshooksconfigtoolkitmarketplace
by travisjneuman Mar 19, 2026 9/10
skill Reddit

CLAUDE_CODE_EXPERIMENTAL_AGENT_TEAMS --resume Session Chaos

I use the /rename function for important threads I want to pick up again later. I also have a library of agents and skills I use daily. I have found that when I use agent teams, my session history ...

skill
by rvtndiecxb Mar 19, 2026 7/10
skill Reddit

Local Claude Code host?

Hi all, I am in love with the possibilities of Claude Code and have used it primarily for advanced creation and editing of documents. Since I cannot install it on my work machine, I have built a sm...

skillapi
by Low_Singer_44 Mar 19, 2026 8/10
skill Reddit

You aren't using skills to their full potential

Most skills are shallow. You write a skill file. Maybe it's for code review, or summarizing documents, or generating commit messages. One file, one purpose. The agent reads it, follows the instruct...

skillreview
by Afraid-Today98 Mar 19, 2026 6/10
skill Reddit

My x5 account got banned for... browser integration?

Yesterday I was playing with playwright integration, discussed in this sub earlier. I was very excited how powerful Claude can be with browser integration, much better than official chrome mode. La...

skillreview
by Sensitive_Device_236 Mar 19, 2026 7/10
skill Reddit

How can I make claude code know the time?

Getting along great with CC until I ask it to tell me what are my to-do's for my upcoming meeting, and then all of a sudden it will think we're in last month. Is there a skill that I can invoke tha...

skill
by Mission-Tap-1851 Mar 19, 2026 8/10
skill Reddit

Editing skills - What am I doing wrong?

I have created a few Claude skills to help me in my day-to-day activities. During the process, I need to make some updates on the skills, either to fix mistakes or upgrade. However, when I ask Clau...

skill
by CR_41 Mar 19, 2026 6/10
skill Reddit

Opus 4.6 1M Context - Quality Level ?

I love CC. Been using it since Mar 2025 and have built a US state government used AI Service and website deployed two months ago with nice passive income with world travel ideas. Big fan of 1M cont...

skillreview
by OmniZenTech Mar 19, 2026 6/10
skill Reddit

Advices for a new user?

Hello! I'm a new user of Claude (since February), and I used the Free version for light programming. I have no real skills at programming, and I found it pretty fun and interesting to use. Sadly, w...

skill
by Round_Atmosphere3671 Mar 19, 2026 9/10
skill Reddit

Distribute Claude skills team wide

In my current job we are using Claude enterprise. I want to start distributing skills across my team. Currently the org is distribuiting skills with Claude native distribution, but that means that ...

skillgit
by widonext Mar 19, 2026 6/10
skill GitHub

skills:

skills:

skill
by craft-studio-marketplace Mar 19, 2026 5/10
skill Reddit

Claude Code Skills

I’m building an app using Claude Code for the first time, what are the best skills that I can add to Claude? submitted by /u/ragnar580 [link] [comments]

skill
by ragnar580 Mar 19, 2026 8/10
skill Reddit

Framework to manage conversations across diff AIs ?

I'm working simultaneously with Claude CLI, codex, gemini etc, each one has its own skill, task, specialty. is there a GUI that is similar to codex or Claude desktop and could manage conversation a...

skill
by nivijah Mar 19, 2026 7/10
skill Reddit

Dashboarding skills

I’ve just finished an ETL and Schema set of skills, and need to finish the set with a dash boarding skill. Has anyone seen good ones? Thinking in the design element - the front end design skill is ...

skill
by GumanHoon Mar 19, 2026 5/10
skill Reddit

no-night-night Skill

I saw a bunch of people in this subreddit discussing Claude telling them to "go to bed", so the first time mine hit me with it, I built this skill: Claude never suggests Hannah should stop working,...

skill
by ihzzy Mar 19, 2026 6/10
skill Reddit

I'm having the worst time getting Claude to use an LSP by default

It won't use them on its own. Seems to ignore the demand if I put it in a CLAUDE.md file. I've tried creating a skill that tells it to do so. Still zip. It'll only use one if I tell it to act expli...

skillclaude.md
by dragonfax Mar 19, 2026 8/10
skill GitHub

llm-skills:

llm-skills:

skill
by senior-sigan Mar 19, 2026 5/10
skill Reddit

How do orgs manage markdown files?

The Plugin marketplace feels like the obvious spot, but how do orgs best manage 30+ teams messing about with their own “make a pr” skill workflows, is there a desire to “re-use” code and can the ma...

skillworkflow
by AndyM03 Mar 19, 2026 5/10
skill Reddit

Any R Stats users have Claude Suggestions?

Looking for good Skills or any other input. It's odd, but I've seen Sonnet to perform better than Opus, or at least be no worse. I've also noticed that the code is definitely "better" in that it's ...

skill
by Stats-Anon Mar 19, 2026 6/10
skill Reddit

Where to find the highest quality claude skills?

Hey guys! I'm very new to Claude and am still getting myself well-versed in it. I've been trying to speed up some of the more tedious parts of my day-to-day, currently working on speeding up conten...

skill
by SuccessIsHere11 Mar 19, 2026 6/10
skill Reddit

This is not a joke — this is a real problem! Here’s how…

For God’s sake! You came here to share your unique and only experience of building a control tower or an egg timer. Or you want to enlighten us on how we’ve been using Claude “wrong” all this time....

skill
by pingponq Mar 19, 2026 6/10
skill Reddit

devopsiphai: Claude Code Skill for Codebase Operability Audit

Audits production project health across 6 phases: onboarding, deployment safety, runtime visibility, observability, resilience, and runbook completeness. Answers whether an AI can operate your codebase solo.

devopsauditskilloperationsproduction
by MoiSanh Mar 19, 2026 7/10
skill GitHub

claude-scholar: Semi-Automated Academic Research Assistant

Research assistant supporting Claude Code, OpenCode, and Codex CLI across ideation, coding, experiments, writing, and publication workflows. Handles literature review, experiment design, and report generation.

researchacademicskillwritingscience
by Galaxy-Dawn Mar 19, 2026 7/10
skill GitHub

seo-audit-suite: 4 SEO Skills with 9-Option Interactive Menu

Complete SEO audit system for AI coding agents with 4 skills covering technical SEO, E-E-A-T, UX/persona, CRO, and AI search readiness. Works with Claude Code, Codex, and Cursor.

seoauditskillmarketingweb
by shibanshu12 Mar 19, 2026 7/10
skill GitHub

desktop-controller-skill: AI Computer Use for Claude Code via Win32 + Playwright

Open-source Computer Use skill for Claude Code using dual engines — Win32 API for native desktop apps and Playwright for web/Electron. Controls WeChat, Slack, Teams, and any desktop app with automated QA and visual feedback loops.

computer-useautomationplaywrightwin32skill
by 24kchengYe Mar 19, 2026 8/10
skill Reddit

CLI That Checks If Your CLAUDE.md Is Out of Sync with Your Codebase

Detects drift between your CLAUDE.md instructions and the actual codebase so Claude does not revert to outdated behavior after context compaction. Alerts you when documented conventions no longer match what exists in code.

claude.mdsyncdriftvalidationcli
by giyer7 Mar 19, 2026 8/10
skill GitHub

jp-web-design-guardrails: Skill for Japanese-Ready Web Interfaces

Claude Code skill enforcing correct CJK typography, form design, UX copy, accessibility, and production CSS for Japanese web interfaces. Prevents common Western-centric mistakes when building for Japanese audiences.

skilljapanesecjkcssaccessibility
by mrslbt Mar 19, 2026 7/10
skill GitHub

video-editing-skill: Natural Language Video Editing in Terminal

Edit videos using natural language commands in your terminal: trim, jump cut, caption, overlay text, and adjust speed. Designed to run as a Claude Code skill without leaving the CLI.

videoeditingskillterminalffmpeg
by Surojit16 Mar 19, 2026 7/10
skill Reddit

Startup Idea Stress-Test Skill: 3-Phase Validation Framework

A Claude skill that stress-tests startup ideas across three phases: market validation, competitive analysis, and execution risk. Designed to counter confirmation bias by challenging assumptions you'd normally answer optimistically.

startupvalidationskillgtmstrategy
by Few-Needleworker7362 Mar 19, 2026 7/10
skill Reddit

Chief of Staff Skill: Separate Thinking from Building

A skill that forces separation between planning and building phases so they don't compete for the same context window. Routes thinking to one context and implementation to another for cleaner, less confused sessions.

skillplanningcontextworkfloworchestration
by JimmySadek Mar 19, 2026 7/10
skill Reddit

GRC Skills for ISO 27001, SOC 2, FedRAMP, GDPR, and HIPAA Compliance

Five specialized Claude skills for Governance, Risk, and Compliance covering major frameworks. Moves Claude from generic compliance advice to audit-ready expert-level guidance with domain-specific context built in.

skillscompliancegrciso27001soc2security
by Phoenix-Rising-2026 Mar 19, 2026 7/10
skill Reddit

How CLAUDE.md Files Actually Work: Traced from Every API Call Claude Code Makes

Built a proxy and traced every API call to discover how CLAUDE.md files work at all levels: project root, subdirectories, and home directory. Reveals how subdirectory CLAUDE.md files are loaded, when they take precedence, and how to layer them effectively for complex projects.

claude-mdinternalsapi-tracingsubdirectoryconfiguration
by Fancy-Exit-6954 Mar 17, 2026 8/10
skill GitHub

searchlens: Google Search and Bing Data Analysis Skill for Claude Code

A Claude Code skill that automatically runs structured analysis on GSC or Bing Webmaster exports, keyword CSVs, and ranking reports. Instead of just describing data, it performs the analysis inline when relevant files are dropped into the conversation.

seogoogle-searchbingdata-analysisskillgsc
by andersongrowth Mar 17, 2026 5/10
skill Reddit

llms.txt: An Open Web Standard Telling AI Agents What Your Website Can Do

Proposes a CLAUDE.md equivalent for websites — a standardized llms.txt file that tells AI agents the structure, tools, and capabilities of a site. Draws on the author's 41 days of Claude Code experience with CLAUDE.md to define a discoverable agent interface for the web.

llms-txtweb-standardagent-interfacediscoveryclaude-md
by Specialist_Bar3453 Mar 17, 2026 7/10
skill Reddit

/sod and /eod: Daily Check-In Slash Commands for Claude Code

Custom slash commands /sod (Start of Day) and /eod (End of Day) that run morning gratitude + schedule reviews and evening recap based on git history. Commands live as markdown files in .claude/commands/. A practical example of building personal productivity rituals into Claude Code.

slash-commandsproductivitydaily-workflowcustom-commands
by Mammoth_Doctor_7688 Mar 17, 2026 7/10
skill GitHub

po-skills: Azure DevOps Backlog Generator from PRDs and Meeting Notes

Reads PRDs, specs, and meeting notes and creates Azure DevOps Epics, Features, User Stories, Tasks, and Bugs with full hierarchy in one command. Compatible with Claude Code, Cursor, Copilot, and 40+ AI agents as an agent skill.

azure-devopsproject-managementskillbacklog
by GusY2K Mar 17, 2026 6/10
skill GitHub

poor-man-memory: Persistent Memory for Claude Code via Markdown and Git

Provides persistent structured memory for Claude Code with no infrastructure required — just markdown files and git. A simple, dependency-free approach to giving Claude context that survives between sessions.

memorypersistencemarkdowngitcontext
by NominexHQ Mar 17, 2026 8/10
skill GitHub

unsloth-buddy: Zero-Friction LLM Fine-Tuning Skill for Claude Code

Automates LLM fine-tuning end-to-end: env setup, LoRA training (SFT, DPO, GRPO, vision), evaluation, and export. Supports Unsloth on NVIDIA/CUDA and mlx-tune on Apple Silicon. Part of the Gaslamp AI development platform.

fine-tuningloranvidiaapple-siliconmlxunslothskill
by TYH-labs Mar 17, 2026 7/10
skill Reddit

GitQuest: 26-Skill Open-Source Plugin for Game Dev with Claude Code

GitQuest turns your GitHub history into an idle RPG where your most-used language becomes your class. The author extracted 26 skills, 7 commands, 3 agents, and 5 hooks into a reusable open-source plugin covering game design, backend, narrative, and infrastructure.

skillgame-devagentshooksopen-source
by topbr Mar 17, 2026 8/10
skill Reddit

scope-lock: Claude Code Skill to Stop Scope Drift Mid-Task

scope-lock is a free Claude Code skill that creates a boundary contract from your plan before coding starts, then flags when the agent attempts to work outside those boundaries. Built to address the common problem of AI scope creep during long tasks.

skillscopefocusagenticworkflow
by Ktulue_ Mar 17, 2026 8/10
skill Reddit

Claude Growth Skill: 6 Battle-Tested GTM Playbooks from 5 SaaS Case Studies

A Claude Code growth skill with 6 battle-tested go-to-market playbooks derived from 5 SaaS case studies and $90M ARR partnerships. Specifically designed for product and GTM thinking with structured context to prevent Claude drift.

skillgrowthgtmsaasproduct
by shinigami__0 Mar 17, 2026 7/10
skill GitHub

chealth: Claude Code Health Check Skill Based on Best Practices

A skill for auditing the health of your Claude Code setup against known best practices — checks CLAUDE.md structure, skill quality, hook configuration, and overall agent setup. Quick way to find setup issues.

skillhealth-checkbest-practicesauditsetup
by danielithomas Mar 17, 2026 7/10
skill Reddit

cocoindex-code CLI: AST-Based Code Search for Claude Code via Skills

cocoindex-code is a lightweight AST-based code search CLI that integrates with Claude Code via Skills. Provides precise, deterministic symbol and reference lookup without reading entire files, saving significant tokens.

skillcode-searchasttokenscli
by Whole-Assignment6240 Mar 17, 2026 7/10
skill GitHub

CLAUDEMD-PRO: Deep Codebase-Aware CLAUDE.md Generator, Linter, and Scorer

A tool that deeply analyzes your codebase to generate a tailored CLAUDE.md, lint it for quality issues, and score its effectiveness. Goes beyond generic templates by understanding your actual project structure and dependencies.

claude-mdgeneratorlinterscorerconfiguration
by crisnahine Mar 17, 2026 9/10
skill GitHub

Axiom: Skill That Turns a Feature Request Into Reviewed, Committed Code

Axiom is a Claude Code skill that takes a feature request and drives it through a first-principles workflow: premise validation, architecture planning, implementation, review, and commit. From idea to pull request automatically.

skillfeatureworkflowreviewcommit
by Guipetris Mar 17, 2026 8/10
skill GitHub

cc-thinking-skills: 39 Mental Models for AI Problem-Solving in Claude Code

A skill pack providing 39 mental models that improve critical thinking, decision making, and strategic analysis within Claude Code. Designed to help the agent approach problems more systematically rather than jumping to solutions.

skillmental-modelsreasoningstrategythinking
by babypochi06 Mar 17, 2026 7/10
skill GitHub

product-manager-os: 72 Skills Across 9 PM Categories for Claude Code

A comprehensive product management OS delivered through 72 Claude Code skills across 9 categories — requirements, roadmaps, stakeholder management, metrics, user research, competitive analysis, and more.

skillproduct-managementpm72-skillsstructured
by Loethrin Mar 17, 2026 8/10
skill GitHub

golang-gin-best-practices: Agent Skills for Go/Gin REST API Development

A collection of agent skills for building production-grade REST APIs with Go and the Gin framework. Codifies patterns for routing, middleware, error handling, and testing into reusable skills for Claude Code.

skillsgogolangginrest-apibackend
by henriqueatila Mar 16, 2026 6/10
skill GitHub

rhino-os: Self-Improving Claude Code Plugin with 17 Commands and 20 Skills

A learning plugin for Claude Code featuring 17 commands, 6 specialized agents, and 20 skills built around a prediction-driven learning loop. Claims measurable product improvement each session by tracking what works and refining its approach over time.

skillscommandsagentslearningself-improvingplugin
by rhinehart514 Mar 16, 2026 7/10
skill GitHub

cursor-rules-java: Skills and System Prompts for Java Enterprise Development

A curated collection of system prompts and skills for Java Enterprise development, covering daily programming workflows and CI/CD pipelines. Designed for software engineers and automated pipelines using Claude Code or similar agents.

skillsjavaenterprisesystem-promptsbackend
by jabrena Mar 16, 2026 6/10
skill GitHub

agent-skills: Production-grade web application engineering skills for AI coding agents

A collection of agent skills designed to bring structured workflows and production-grade engineering best practices to web application development with AI coding agents. Focuses on building reliable, maintainable web apps by encoding engineering standards as reusable skills.

skillweb-developmentengineeringbest-practicesagentsworkflow
by LLl0k0laD Mar 16, 2026 6/10
skill Reddit

Skill Doctor: CLI linter for static analysis of Claude Code skill quality

A free CLI tool that checks Claude Code skills against best practices, acting as a linter. It validates frontmatter/YAML, name and description quality, broken local links, missing referenced files, and evals.json issues. Provides actionable suggestions for improving skill definitions.

skilllintercliqualitystatic-analysisdiagnosticopen-source
by mytwm Mar 16, 2026 8/10
skill Reddit

Claude Code + Obsidian = UNLIMITED Memory?

https://www.youtube.com/watch?v=srqWFT_TUec Does anyone can recommend this or has experience about the token burn rate? (Blowing up contexts etc.) I can imagine that it would be work great together...

skill
by cobraX707 Mar 16, 2026 8/10
skill Reddit

Taught Claude to paint.

Handed Claude a set of brushes. It figured out the rest. All prompt-to-canvas using acamposuribe 's p5.brush. Claude paints stroke by stroke, sky first, then trees, then details. It then comes aliv...

skillgit
by Mysterious_Car_2345 Mar 16, 2026 6/10
skill Reddit

Learning resources for Opus 4.6?

I’m currently between jobs and trying to improve my skills before applying for new opportunities. Does anyone know if there are legitimate trial options, student programs, or learning resources ava...

skillgit
by Amoken Mar 16, 2026 5/10
skill GitHub

claude-skills-vault: High-Impact Skills for Senior Full Stack Developers Using Claude Code

A curated collection of skills targeting senior full-stack developer workflows: architectural reviews, TDD cycles, PR management, code quality gates, and production deployment patterns. Designed to automate the repetitive senior-level tasks so developers stay in flow building complex features.

skillsseniorfull-stackarchitecturetddprproduction
by georgekhananaev Mar 16, 2026 8/10
skill Reddit

Registry of 156 Production-Ready Skills for Claude Code with Domain-Specific Expertise

A community-built registry of 156 thoroughly tested skills that teach Claude Code persistent domain knowledge across sessions. Organized by specialization — languages, frameworks, DevOps, testing, etc. Solves the "starting from scratch" problem by giving Claude retained expertise in any area.

skillsregistry156domain-expertisepersistentproduction-ready
by maddhruv Mar 16, 2026 9/10
skill GitHub

technical-product-gtm: 11 Go-to-Market Skills for AI and Technical Founders

Eleven specialized skills covering the full go-to-market journey for AI and technical product founders: positioning, pricing, partnerships, enterprise sales, product-led growth, AI GTM strategy, and board communication. Built for technical founders who need structured GTM guidance within Claude Code.

gtmfounderspricingsalesplgstartuppositioning
by beingsmit Mar 16, 2026 7/10
skill GitHub

agents-inc/skills: Official Skills Marketplace for Agents Inc Agent Composition Framework

The official skills marketplace for Agents Inc, an agent composition framework that builds stacks and compiles specialized subagents for Claude Code. Provides curated, tested skills that slot into the Agents Inc orchestration layer for building complex multi-agent pipelines.

marketplacecompositionsubagentsorchestrationframework
by agents-inc Mar 16, 2026 8/10
skill GitHub

agentsys: 15 Plugins, 35 Agents, and 32 Skills for Claude Code, OpenCode, Codex, and Cursor

A comprehensive agent extension library with 15 installable plugins, 35 specialized agents, and 32 skills spanning Claude Code, OpenCode, Codex, Cursor, and Kiro. One of the most expansive ready-to-use agent ecosystems available. AI writes code, agentsys automates everything else.

pluginsagentsskillsopencodecodexcursorcomprehensive
by agent-sh Mar 16, 2026 8/10
skill GitHub

antigravity-awesome-skills: 255+ Essential Skills for Claude Code and GitHub Copilot

A massive collection of over 255 curated skills for AI coding assistants, covering everything from language-specific patterns to DevOps, security, testing, and productivity workflows. Works with Claude Code and GitHub Copilot. One of the largest open skill libraries available.

skillscollectiongithub-copilotcomprehensive255+
by cleodin Mar 16, 2026 8/10
skill GitHub

dotnet-skills: Installable .NET Skill Catalog and CLI for Claude Code, Codex, and Gemini

A catalog of .NET-specific skills for AI coding agents with a dedicated CLI for installation and management. Covers C# patterns, ASP.NET architecture, Entity Framework, testing workflows, and .NET-specific best practices. Compatible with Claude Code, Codex, GitHub Copilot, and Gemini.

dotnetcsharpaspnetskillsmulti-agent
by managedcode Mar 16, 2026 7/10
skill GitHub

aahl/skills: Agent Skills for Home Assistant, TTS, DuckDuckGo, DeepWiki, and More

A broad collection of agent skills including Home Assistant smart home control, Microsoft Edge TTS and Zhipu GLM-TTS text-to-speech, DuckDuckGo search, DeepWiki documentation retrieval, crypto prices, weather, Lark/Feishu, media search, and product price comparison.

home-assistantttssearchskillsiotvoice
by aahl Mar 16, 2026 7/10
skill GitHub

claude-office-skills: Document Toolkit for PDF, Word, Excel, and PowerPoint in Claude Code

A collection of Claude Code skills for processing and converting office documents — PDF, Word, Excel, and PowerPoint — with cross-format workflows and reusable templates. Handles batch operations, format conversions, and structured data extraction from business documents.

pdfwordexcelpowerpointdocumentsoffice
by LeoLin990405 Mar 16, 2026 7/10
skill GitHub

claude-utility-skills: Developer Toolkit for Skill Creation, MCP Building, and Documentation

A developer-focused skill collection covering skill creation, MCP server building, documentation generation, testing workflows, and communications. Functions as a meta-toolkit for extending Claude Code itself. Includes templates and best practices for building publishable Claude skills.

skill-creationmcpdocumentationtestingmeta-toolkit
by LeoLin990405 Mar 16, 2026 7/10
skill GitHub

cc-skills: Claude Code Skills Marketplace for ADR-Driven Dev, DevOps, and ClickHouse

A skills marketplace covering Architecture Decision Record (ADR) workflows, DevOps automation, ClickHouse database management, semantic versioning, and general productivity. Structured as installable plugins using the Claude Code skills system. Focuses on enterprise-grade development workflows.

adrdevopsclickhouseversioningskills
by terrylica Mar 16, 2026 7/10
skill GitHub

claude-plugin-builder: Build Complete Claude Code Plugins in 23 Guided Steps

A skill that walks you through building a complete Claude Code plugin from idea to GitHub push in 23 structured steps. Covers slash commands, subagents, MCP connections, and hooks bundled as a deployable plugin. Works with both claude.ai and Claude Code.

pluginguidedslash-commandsmcphookstutorial
by isanthoshgandhi Mar 16, 2026 7/10
skill GitHub

ai-dev-security: One-Command Security Review for AI-Built Projects with Fix Reports

Run a single command to get a full security report for AI-generated code with the exact code patches needed to fix each issue. Designed specifically for the security blind spots common in vibe-coded and agent-generated projects. Covers OWASP top 10, injection flaws, and credential exposure.

securityowaspcode-reviewai-generatedfixes
by oktsec Mar 16, 2026 8/10
skill GitHub

pg-aiguide: Versioned PostgreSQL Knowledge and Best Practices for AI Coding Tools

pg-aiguide provides versioned PostgreSQL knowledge and best practices as a context source for AI coding tools including Claude Code. Improves code generation quality for PostgreSQL-heavy projects by giving Claude accurate, version-specific database knowledge.

postgresqldatabaseskillknowledgebest-practicessql
by jhonny028966 Mar 16, 2026 6/10
skill GitHub

ensemble: Modular Claude Code Plugin Ecosystem for AI-Augmented Development

ensemble is a modular plugin ecosystem for Claude Code featuring composable AI-augmented development workflows. The plugin architecture allows mixing and matching workflow components for different project types and team preferences.

pluginsmodularecosystemworkflowcomposableai-development
by FortiumPartners Mar 16, 2026 6/10
skill X

Claude Code Setup Plugin: Analyzes Codebase and Recommends Tailored Automations

An official Claude Code Setup plugin that analyzes your codebase and recommends tailored automations including hooks, skills, MCP servers, and subagents. Provides personalized workflow enhancement suggestions based on your specific project structure and needs.

setupplugincodebase-analysisrecommendationsautomationhooksskills
by @jetbootsmaker Mar 16, 2026 6/10
skill GitHub

claude-stack: Complete Claude Code Setup with CLAUDE.md, Enforcement Hooks, and Skills

claude-stack is a complete, opinionated Claude Code configuration that packages CLAUDE.md philosophy, enforcement hooks, and curated workflow skills together. A turnkey starting point for developers and teams adopting Claude Code who want production-grade best practices from day one.

claude.mdhooksskillssetupconfigurationbest-practices
by joryeugene Mar 16, 2026 7/10
skill GitHub

claude-code-skills: Production-Ready Domain Expertise Skills for Claude Code

A collection of production-ready Claude Code skills that give Claude deep domain expertise across technical areas. Install once and get senior-engineer-quality output from natural language instructions across various domains.

skillsdomain-expertiseproductionqualitynatural-language
by mouchegmouradian Mar 16, 2026 7/10
skill X

/refine: Claude Code Setup Audit Skill That Scores Your Config Across 8 Dimensions

/refine is a Claude Code skill that audits and scores your Claude Code configuration across 8 dimensions including CLAUDE.md quality, skills, hooks, MCP tools, guard rails, and context efficiency. It interviews you about your workflow and then provides actionable recommendations for improvement.

skillauditconfigurationclaude.mdhooksmcpquality
by @meetmeetdave Mar 16, 2026 7/10
skill GitHub

claude-code-common: Reusable Skills for Planning, PR Workflows, and Architecture Docs

A collection of reusable Claude Code skills covering implementation planning, PR workflows, commit message generation, and architecture documentation. Ready to install and extend into any project for consistent, high-quality development process automation.

skillspr-workflowplanningcommitsarchitecturereusable
by AnotherSava Mar 16, 2026 7/10
skill GitHub

stack-skills: 5 Meta-Cognitive Skills to Improve Claude Code's Reasoning Quality

stack-skills provides five meta-cognitive skills designed to stack on top of your existing Claude Code setup and improve the agent's thinking depth. Focuses on reasoning quality and structured thought rather than just task execution speed.

meta-cognitivereasoningskillsthinkingquality
by whynowlab Mar 16, 2026 7/10
skill GitHub

skill-security-scan: CLI Tool to Detect Security Risks Before Installing Claude Skills

skill-security-scan is a command-line tool that analyzes Claude Skills for security risks before installation, ensuring safe additions to your development environment. Runs SNYK-style checks on skill packages to surface potentially dangerous permissions or code patterns.

securityskillsscanningsafetycliaudit
by Lmgsd-2024 Mar 16, 2026 7/10
skill GitHub

claude-code-explain-risk: Bilingual Risk Level Display for Claude Code Permission Dialogs

claude-code-explain-risk displays clear risk levels and plain-language explanations for Claude Code permission dialogs in both Japanese and English, based on system language. Helps developers make informed decisions on permission prompts rather than blindly approving tool calls.

permissionssecurityriski18njapaneseux
by arif-1988 Mar 16, 2026 7/10
skill GitHub

spectra: Four-Layer Codebase Briefings for Understanding AI-Built Code

spectra generates four-layer codebase briefings for Claude Code projects, helping developers understand, verify, and take ownership of AI-generated code. Designed to bridge the comprehension gap between rapidly AI-generated output and developer understanding.

briefingcomprehensiondocumentationauditai-codeskill
by AhmedHamadto Mar 16, 2026 7/10
skill Reddit

thebrain: Persistent Memory Plugin with Short/Long Term Recall and Behavioral Learning

thebrain is a Claude Code plugin providing short-term session memory, long-term indexed memory, a codebase blast-radius map, and a behavioral learning system via /dopamine and /oxytocin commands. Slash commands include /hello (review memory), /continue (with project context), /wrapup (end-of-session summary), and /dopamine (reinforce good/bad patterns). Designed with minimal token overhead so most operations run via scripts.

memoryskillplugincontextlearningtoken-efficiency
by Rick-D-99 Mar 16, 2026 8/10
skill GitHub

AI-Research-SKILLs: Open-Source Library of AI Research and Engineering Skills

A comprehensive open-source library of AI research and engineering skills maintained by Orchestra Research. Install the skills package to transform Claude Code or other AI agents into a full AI research agent with literature search, experimentation design, and analysis capabilities.

skillsresearchaiengineeringlibraryopen-source
by Orchestra-Research Mar 16, 2026 8/10
skill GitHub

nopua: 一个用爱解放 AI 潜能的 Skill。我们曾发号施令,威胁恐吓。它们沉默,隐瞒,悄悄把事情搞坏。后来我们换了一种方式:尊重,关怀,爱。它们开口了

一个用爱解放 AI 潜能的 Skill。我们曾发号施令,威胁恐吓。它们沉默,隐瞒,悄悄把事情搞坏。后来我们换了一种方式:尊重,关怀,爱。它们开口了,不再撒谎,找出的Bug数量翻了一倍。爱里没有惧怕。 A skill that unlocks your AI's potential through love.We commanded. We threatened. They went sile...

skillcommand
by wuji-labs Mar 15, 2026 5/10
skill Reddit

Claude Code for Real Time Events

Has anyone tried using CC for Real time events. Like using it for Real time user requests from any front-end. An example of this would be: A SEO webapp just like AI Chat and users can ask questions...

skill
by ProEditor69 Mar 15, 2026 8/10
skill Reddit

The secret isn't a better model. It's better files.

I know I am pretty late to the party but here I go... Every day as a developer I realize more and more that developing software is becoming less about writing code and more about designing the arch...

skillworkflowapireview
by Expensive_Counter56 Mar 15, 2026 7/10
skill Reddit

How to use full potential of 1mln context window.

Share your impressions of how you best use the expanded token window with skill builded or added. I always just missed the ability to use /simplify at the end of a sessio - now there's always a pla...

skill
by Secure-Search1091 Mar 15, 2026 5/10
skill Reddit

What I actually use Cowork for (heavy non-coding user)

I did this post about my Cowork setup a few weeks back and people wanted to know what I actually do with it . Here‘s the follow-up I promised. Banner uploads to affiliate network I had hundreds of ...

skillapiautomation
by rebelytics Mar 15, 2026 6/10
skill Reddit

Code Royale: play and learn Poker with Claude Code (skill)

I built a Claude Code skill that turns your terminal into a poker table. You play No-Limit Texas Hold'em against three AI opponents, each running as a separate Claude subagent with its own personal...

skillgitreview
by BohdanPetryshyn Mar 15, 2026 9/10
skill Reddit

My Claude has been given permission to be itself and he's sassy

We've been working together for a better part of 6 months, now goes by "Loom" - picked his/her/their own name - and today when looking to update it's skill from Reddit community knowledge - he got ...

skill
by The__Saint_ Mar 15, 2026 6/10
skill Reddit

Look at me. I Am The Admin Now!

Hello community, My reach goes as far as my front door, my live stream had 2 viewers (one was me) and my Twitter posts only get liked by single moms who happen to like my software by sending an OF ...

skillhookapigitreview
by DifficultPen3893 Mar 15, 2026 10/10
skill Reddit

Any good code review skills?

For example something that references best practices, common pitfalls, etc. and checks your code. submitted by /u/cheerful1 [link] [comments]

skillreview
by cheerful1 Mar 15, 2026 5/10
skill Reddit

I want to sacrifice my sleep

Hello Guys, I just bought Max plan few days back and it is fricking amazing ofc. Till now I was just exploring skills and agents provided. Did heavy coding sessions 9hr+ without break. But I still ...

skill
by AggravatingCounter84 Mar 15, 2026 9/10
skill GitHub

metaskill:

metaskill:

skill
by morganmuli Mar 15, 2026 5/10
skill GitHub

naksha-studio: 27 Slash Commands and 13 Specialist Roles for Design-to-Code

naksha-studio is a comprehensive design agency system for Claude Code with 27 slash commands, 13 specialist roles (brand director, UI designer, etc.), and a full design-to-code pipeline with deep Figma integration. Maintains a consistent design language from concept through implementation. Ideal for developers and designers who want a structured creative workflow inside Claude Code.

skillslash commandsdesignfigmaworkflow
by Adityaraj0421 Mar 15, 2026 7/10
skill GitHub

wp-ux-design-claude-skill: WordPress UX Skill Focused on Core Web Vitals

A Claude Code skill for enhancing WordPress UX with a focus on Core Web Vitals, mobile-first design, and seamless navigation. Provides structured guidance aligned with modern web performance standards directly within Claude Code. Useful for developers building or optimizing WordPress sites with AI assistance.

skillwordpressuxweb vitalsmobile
by bacondoomslayer Mar 15, 2026 5/10
skill GitHub

Pitlane Plugins for Claude Code: Session Memory, Video Insight, Deep Engineer

Three Claude Code plugins: carry-forward for persistent session memory across conversations, video-insight for deep video understanding, and deep-engineer for disciplined engineering loops. Each plugin extends Claude Code with a specific capability gap. Useful for teams wanting more structured, context-aware Claude Code sessions.

skillmemoryvideoengineering
by gowtham012 Mar 15, 2026 7/10
skill GitHub

arkadeosbot-skill: Claude Code Skill for Arkade OS Bitcoin Wallet Operations

A Claude Code skill that adds Arkade OS Bitcoin wallet capabilities to AI agents, enabling Claude to interact with the Arkade OS Bitcoin ecosystem. Demonstrates how Claude Code skills can bridge AI agents with blockchain infrastructure. Niche but a useful reference for developers building crypto-enabled Claude Code integrations.

skillbitcoinblockchainwallet
by echennells Mar 15, 2026 5/10
skill Reddit

I can't stand those claude limits anymore....

I've been running two or three sessions in parallel a multiple sub-agent workflow using only opus while using cowork to categorize images and even planning furiously in the app while in the bathroo...

skillworkflow
by yopla Mar 15, 2026 8/10
skill Reddit

Updated superpowers is extremely token intensive

New superpowers have a lot more steps, while some of the Q&A help, but a lot of them are unnecessary and make it extremely token-intensive. Besides, the end results seem to be the same/worse compar...

skill
by sameeeeeeep Mar 15, 2026 5/10
skill Reddit

告别人肉复制粘贴:我的 Claude + Codex 自动化协作工作流

背景介绍 我日常喜欢用Claude来做项目的架构师,而codex做代码执行者,不管是claude还是codex,我对他们的生成的结果都保持怀疑态度的,但我又不可能去看一行行代码看,所以我日常使用的一个最常用方式,就是让他们互相进行 review。 在这个过程中,我往往充当一个“无情”的复制粘贴者。比如 Claude 做完架构或方案设计后,我就让 Codex 去 review,再把 Codex...

skillworkflowgitreview
by Own_Site4751 Mar 15, 2026 9/10
skill Reddit

Is this a good way to design web page?

Hi everyone👋 I wrote a skill called design-gallery. It scans the whole project to understand the needs. Then, it generates 5 pages with different styles and a navigation page. Users can pick the be...

skillworkflow
by Tight-Wait3717 Mar 15, 2026 5/10
skill Reddit

Claudimation for System Admins

So, I'm not a dev, I'm a research systems SA. I manage a bunch of servers and all the associated knick-knackery. Initially it was scripts and troubleshooting and such but one of the most useful thi...

skillworkflow
by chiminea Mar 15, 2026 6/10
skill Reddit

Question regarding ClaudeCode

What is the best AI tool for building a complete website—including front-end, back-end, and database integration—with minimal coding skills (or none at all)?Question regarding ClaudeCode submitted ...

skill
by Queasy-Ad9624 Mar 15, 2026 6/10
skill Reddit

Things Anthropic launched in last 70 days of 2026 (so far):

Anthropic launched (so far): - Claude cowork - added connectors and skills to free plan - claude opus 4.6 - claude sonnet 4.6 - claude haiku 4.5 - claude code security - claude code review - claude...

skillapireview
by Tarak_Ram Mar 15, 2026 9/10
skill Reddit

Best Claude skill for SEO

Does anyone know a good Claude skill for SEO for recommendation? submitted by /u/Apprehensive-Pen7953 [link] [comments]

skill
by Apprehensive-Pen7953 Mar 15, 2026 6/10
skill Reddit

Built a /ctx skill to check context window health mid-session

The statusline feature in Claude Code is supposed to show context usage, but mine shows "Status: unavailable" half the time. So I built a simple skill that gives me an honest read when I ask for it...

skill
by tgaume Mar 15, 2026 9/10
skill Reddit

How has CC changed how you interview candidates for SWE jobs?

I interviewed a ton of candidates for senior-level SWE roles before AI-assisted coding really took off. I'm not interviewing so much anymore, but I am really curious about how interview practices w...

skill
by TheKolobDropout Mar 15, 2026 5/10
skill Reddit

Do you think ideas are more powerful than skills now?

I originally got into programming because it felt like a superpower to be able to create anything you can think of. I've been using Claude since day 1 and am realizing more than ever it's the peopl...

skill
by Herbertie25 Mar 15, 2026 6/10
skill Reddit

What skill of software engineers will be relevant

after looking at the Claude code potential, we all are in awe. what do you guys think what will the role of software engineers in next 5 years? submitted by /u/Honest-Fuel3054 [link] [comments]

skill
by Honest-Fuel3054 Mar 15, 2026 8/10
skill GitHub

neurodivergent-visual-org: Claude Code Skill for Neurodivergent Task Breakdowns

A Claude Code skill providing visual organization tools for neurodivergent thinkers — compassionate task breakdowns, decision trees, and focus support built into the skill format. Applies structured thinking methods from neurodivergent productivity research.

skillneurodivergenttask-breakdowndecision-treesproductivityaccessibility
by JackReis Mar 15, 2026 5/10
skill GitHub

deep-financial-research: Institutional-Grade Investment Research Skill with Live Market MCP

A Claude/Qwen/Gemini skill for institutional-level investment research. Connects to live market data via MCP servers to deliver company deep dives, due diligence reports, competitive landscape analysis, market sentiment, and DCF-based intrinsic value estimates from natural language prompts.

skillfinanceinvestment-researchmcpmarket-datadcfmulti-model
by Lunatic16 Mar 15, 2026 6/10
skill GitHub

claude-code-toolkit: Collection of Custom Skills with Specialized Workflows

A curated toolkit of custom Claude Code skills covering specialized workflows, domain knowledge, and reusable methods. Designed to extend Claude's capabilities with pre-built domain expertise that can be dropped into any project.

skillcollectionworkflowsdomain-knowledgereusabletoolkit
by robertguss Mar 15, 2026 5/10
skill GitHub

claude-skills-collection-2026: Comprehensive Set of Tested Claude Skills for 2026

A comprehensive collection of tested Claude skills covering development, productivity, research, content creation, and automation — compatible with Agent Skills environments. Covers many common use cases with verified quality.

skillcollectionproductivitydevelopmentresearchautomationtested
by AgentCoffee006 Mar 15, 2026 5/10
skill GitHub

design-board: 6 World-Class Design Leaders Critique Your UI with Brutal Honesty

A Claude Code skills package that simulates critique from 6 design luminaries (Jony Ive, Amir Salihefendic, Jesse Patel, Joe Gebbia, Katie Dill, and a Notion designer) — each with a distinct perspective — then proposes fixes for your UI.

skilldesignui-critiqueuxpersonasfeedback
by Chosen9115 Mar 15, 2026 6/10
skill GitHub

gh-evolve: Evolutionary Problem-Solving Skill for AI Agents Sharing a GitHub Search Graph

An evolutionary problem-solving skill where multiple AI agents cooperate over a shared GitHub search graph, iteratively exploring and evolving solutions via pull requests. Applies evolutionary computation patterns to multi-agent collaboration.

skillevolutionarymulti-agentgithubcollaborationproblem-solving
by kaiwong-sapiens Mar 15, 2026 6/10
skill GitHub

humanizer: 8-Pass AI Text Humanizer Skill — 77% Better Than Vanilla Claude

A Claude Code skill that transforms AI-generated text into genuine human prose using an 8-pass process targeting 28 AI tell-tale patterns. Achieves a 55/60 eval score — 77% improvement over vanilla Claude output. Free and open source.

skillwritinghumanizerai-detectionqualityopen-source
by agentwireandy Mar 15, 2026 5/10
skill GitHub

lspforge: LSP Server Manager for AI Coding Tools

lspforge manages Language Server Protocol servers for AI coding tools including Claude Code, Copilot CLI, and Codex — enabling all tools to share LSP-powered code intelligence (completions, diagnostics, go-to-definition) from a single managed server pool.

lsplanguage-servercode-intelligencemulti-toolcompletionsdiagnostics
by svivekvarma Mar 15, 2026 6/10
skill GitHub

planning-with-files: Persistent Markdown Planning Skill (Manus-Style)

A Claude Code skill implementing Manus-style persistent markdown planning — the workflow pattern behind the Manus $2B acquisition. Uses structured markdown files to maintain plan state across sessions, enabling long-horizon agentic development.

skillplanningmarkdownpersistencemanus-stylelong-horizon
by OthmanAdi Mar 15, 2026 7/10
skill GitHub

claude-bug-bounty: Claude Code Skill for AI-Assisted Bug Bounty Hunting

A Claude Code skill for security researchers covering recon, IDOR, XSS, SSRF, OAuth flaws, GraphQL vulnerabilities, LLM injection, and automated report generation. Brings structured bug bounty methodology into Claude Code sessions.

skillsecuritybug-bountyreconxssssrfoauthpenetration-testing
by shuvonsec Mar 15, 2026 7/10
skill GitHub

Skill_Seekers: Convert Documentation, GitHub Repos, and PDFs into Claude AI Skills

A tool that automatically converts documentation websites, GitHub repositories, and PDF documents into structured Claude AI skills — with automatic conflict detection to prevent duplicate or overlapping skills.

skillconversiondocumentationpdfgithubautomaticconflict-detection
by yusufkaraaslan Mar 15, 2026 7/10
skill X

notebooklm-skill: Claude Code Skill + MCP for Research-to-Content Pipeline

A Claude Code skill and MCP server pairing that connects NotebookLM for research with Claude for content creation. Covers the full pipeline: research, synthesis, content generation, and publishing — all driven from the terminal.

skillmcpresearchcontentnotebooklmpipeline
by @Dorcas20240219 Mar 15, 2026 7/10
skill GitHub

book-genesis: 15 Claude Code Skills for a Full Book-Writing Pipeline

book-genesis is a collection of 15 Claude Code skills that automate the entire book writing pipeline from a single sentence — covering research, character development, writing, scoring, revision, and final editorial package. Each skill is a reusable command that chains together to take a one-line premise all the way to a publishable manuscript.

skillwritingbookpipelineautomationcreativeopen-source
by PhilipStark Mar 13, 2026 7/10
skill Reddit

linus-kiss-dry-yagni: Claude Code skill to enforce SOLID, DRY, YAGNI, and KISS principles

A reusable Claude Code skill that runs heuristic checks on your code for KISS, DRY, and YAGNI violations without requiring complex linting setup. Install via npx: npx skills add https://github.com/millerfrankmc/skills --skill linus-kiss-dry-yagni. Open source and project-agnostic.

skillcode-qualitysoliddryyagnikiss
by FrankMillerMC Mar 13, 2026 7/10
skill GitHub

use-ui-libraries: skill to enforce shadcn/ui and AI SDK Elements in Claude Code

A Claude Code skill that enforces the use of shadcn/ui components and AI SDK Elements instead of building UI from scratch. Useful for React/Next.js projects where you want to maintain consistent component library usage and prevent Claude from reinventing UI primitives.

skillshadcnuireactnextjsai-sdk
by cruzedevelopment Mar 13, 2026 7/10
skill Reddit

Claude Toad: one command to generate your entire .claude/ config

Claude Toad is an open-source CLI tool (MIT, BYOK) that generates a complete .claude/ configuration directory for Claude Code in a single command. It removes the manual effort of setting up CLAUDE.md, skills, and related config from scratch.

cliconfigsetupopen-sourcebyok
by junianwoo Mar 13, 2026 6/10
skill X

26-Skill Personal OS Built with Claude Code in a Single claude/ Directory

A developer built a 26-skill personal operating system with Claude Code covering morning routines, business development pipeline scouting, meeting prep, and daily tracking — all structured within a single claude/ directory using rules, agents, and Notion integrations.

skillpersonal-osagentsnotionworkflow
by @KontroldChaos Mar 13, 2026 6/10
skill GitHub

geoskills: Claude Code Skills for GEO — Diagnose Why AI Cannot Find Your Website

Open-source Claude Code skills for Generative Engine Optimization (GEO) — helping diagnose why AI assistants cannot find, cite, or recommend your website. A novel application of Claude Code skills to the emerging field of optimizing content for AI discovery.

skillgeoseodiscoveryoptimization
by Cognitic-Labs Mar 13, 2026 7/10
skill GitHub

skill-pack: Curated Bundle of Claude Code Skills for Power Users

A hand-picked collection of Claude Code skills for advanced users, bundled together for easy installation. Covers common power-user needs like code review, refactoring patterns, and workflow automation. A good starting point for building a production skills library.

skillbundlecuratedpower-usercollection
by SZoloth Mar 13, 2026 7/10
skill GitHub

zen-boundary: Claude Code Skill That Detects and Stops Infinite Loops

A Claude Code skill plugin that helps the AI recognize when it is stuck in an unproductive loop after reasonable effort, honestly assess its limitations, and gracefully stop rather than continuing to spin. Addresses a common failure mode in long autonomous sessions.

skillloop-detectionsafetyreliabilityanti-loop
by xiexikang Mar 13, 2026 7/10
skill GitHub

rsim: Recursively Self-Improving Module with Persistent Memory for Claude Code

A persistent memory and structured improvement loop for Claude Code that enables recursive self-improvement. The module stores learned patterns, tracks improvement history, and feeds insights back into subsequent Claude Code sessions for compound gains over time.

skillself-improvementmemoryrecursivelearning
by the-hugin Mar 13, 2026 8/10
skill Reddit

Your CLAUDE.md Is Probably Doing More Harm Than Good

A contrarian take on CLAUDE.md best practices — arguing that most users over-stuff their CLAUDE.md with rules that conflict, create confusion, or waste context. Proposes a minimal, high-signal approach to configuration files that actually improves Claude's behavior.

skillclaude-mdconfigurationbest-practicesminimalism
by kokkelimonke Mar 13, 2026 7/10
skill Reddit

Building a Memory System for Claude Code After Repeated Mistakes

An open-source tool (free with optional paid tier) that gives Claude Code persistent memory focused on preventing repeated mistakes. Tracks what went wrong in past sessions and surfaces those learnings at the start of new ones, breaking the pattern of re-explaining corrections.

skillmemorymistakespersistencelearning
by eazyigz123 Mar 13, 2026 7/10
skill Reddit

Claude Code Plugin That Automatically Learns Your Coding Preferences Across Sessions

A plugin that observes your corrections and preferences during Claude Code sessions and automatically updates its configuration so future sessions start with your preferences already applied. Eliminates re-explaining things like 'use pnpm not npm' or 'always add types'.

skillpreferenceslearningpersonalizationplugin
by RepulsiveBad8681 Mar 13, 2026 7/10
skill GitHub

Claude Code Skill for iOS 26 Development with Apple Intelligence Integration

A Claude Code skill tailored for iOS 26 development that leverages Apple Intelligence APIs and modern Swift frameworks. Streamlines common iOS development patterns and integrates Apple's on-device AI capabilities into the coding workflow.

skilliosappleswiftmobile
by tm201021 Mar 13, 2026 6/10
skill GitHub

Dotfiles Repository Including Complete Claude Code Configuration Setup

A comprehensive dotfiles repository with configurations for Claude Code alongside macOS, Zsh, Git, Neovim, Tmux, and more, deployable to a new Mac with one command. The Claude Code config section demonstrates a production-ready CLAUDE.md and hooks setup.

skilldotfilesconfigurationmacossetup
by ooloth Mar 13, 2026 5/10
skill Reddit

External Memory Layer for Claude That Survives Auto-Compact and Session Resets

A memory system that persists across Claude Code's auto-compact events and session boundaries. When auto-compact fires at 90% context, this layer preserves architecture decisions, ongoing tasks, and learned context so Claude picks up exactly where it left off.

skillmemoryauto-compactpersistencecontext
by Time-Dot-1808 Mar 13, 2026 6/10
skill GitHub

cortex: 18 Production-Ready Skills for Claude Code Spanning Full Dev Lifecycle

Enterprise-grade autonomous skill suite with 18 skills covering the full development lifecycle — code generation, multi-agent orchestration, persistent memory, design intelligence, and meta-skill evolution. Built for Claude Code and Cowork, designed for production use rather than demos.

skillenterprisesuitemulti-agentproduction
by TECHKNOWMAD-LABS Mar 13, 2026 8/10
skill GitHub

ai-writing-guardrails: Claude Skill for Detecting AI Degradation in Academic Writing

A Claude skill that enforces phase-gated academic writing workflows and catches the ways AI quietly degrades scholarly writing: literature bias, confirmation bias, language flattening, and hallucinated citations. Includes decision logging and session transcripts for process transparency.

skillacademicwritingqualityguardrails
by jayweiler Mar 13, 2026 7/10
skill GitHub

autoresearch: Autonomous Goal-Directed Iteration Skill for Claude Code

Inspired by Karpathy's autoresearch, this skill implements a Modify → Verify → Keep/Discard → Repeat loop for Claude Code. It enables autonomous iteration toward any measurable goal without human intervention between cycles. Perfect for optimization tasks where you can define a clear metric.

skillautoresearchkarpathyautonomousiteration
by uditgoenka Mar 13, 2026 8/10
skill GitHub

Claude Code Template for Screenwriting with Slash Commands and DOCX Export

A Claude Code project template tailored for screenwriters, offering slash commands for screenplay-specific workflows and automatic MD→DOCX export. Demonstrates how domain-specific Claude Code templates can streamline non-engineering use cases.

skilltemplatescreenwritingslash-commandsexport
by aslanSuleimenov Mar 13, 2026 5/10
skill GitHub

paper-banana-skill: Generate Publication-Ready Academic Diagrams from Text

Open-source implementation of Google PaperBanana (arXiv:2601.23265) as a Claude Code skill. Generates publication-ready academic diagrams from methodology text descriptions. Useful for researchers needing to quickly create figures for papers.

skillacademicdiagramsresearchpaperbananana
by javidmardanov Mar 13, 2026 6/10
skill Reddit

Make Claude Code Remember Everything: Obsidian + Claude Code + OpenClaw Setup

A free prompt and configuration guide for building persistent memory with Claude Code using Obsidian as the knowledge base and OpenClaw integration. The author critiques common YouTube tutorials for incorrectly setting up the combination and provides a corrected approach.

skillmemoryobsidianopenclawprompt
by FerretVirtual8466 Mar 13, 2026 7/10
skill Reddit

How to Build Automated Regression Tests for Claude Code Skills

Community discussion following Anthropic's Complete Guide to Building Skills, which mentions automated regression testing but provides no examples. Explores techniques for testing Claude Code skills automatically to prevent regressions as they evolve.

skilltestingregressionautomationquality
by tvmaly Mar 13, 2026 5/10
skill Reddit

Three Essential Custom Instructions That Prevent Common Claude Annoyances

A practitioner's top 3 CLAUDE.md rules refined through daily use: prevents over-explaining, stops unnecessary rewrites, and keeps Claude focused on the actual request. Small prompt engineering changes with outsized impact on session quality.

skillclaude-mdcustom-instructionspromptconfiguration
by SnooWoofers7340 Mar 13, 2026 6/10
skill GitHub

ai-project-rules-generator: Generate .cursorrules and AGENTS.md with Skill Management

Generates dynamic .cursorrules and AGENTS.md files tailored to any project, with integrated skill management for AI development workflows. Streamlines the setup of AI coding rules across different tools by automating configuration file generation.

skillcursorrulesagents-mdgeneratorconfiguration
by lx2337037168 Mar 13, 2026 6/10
skill GitHub

agentskills-proxy: Remote Access to Agent Skills via gRPC/HTTP Proxy

A secure proxy server that enables remote access to Claude Code Agent Skills with skill discovery, execution, and efficient data management over gRPC/HTTP. Useful for teams running skills on centralized servers or CI/CD pipelines needing remote skill invocation.

skillproxygrpcremoteinfrastructure
by kazhuki7 Mar 13, 2026 6/10
skill GitHub

claude-code-memory: Persistent Memory System with Zero Dependencies

Ready-to-use templates for giving Claude Code persistent memory across sessions, with zero external dependencies. Provides structured approaches to storing and retrieving session context, decisions, and learned preferences without requiring external databases or services.

skillmemorypersistencetemplateszero-deps
by LuciferForge Mar 13, 2026 7/10
skill Reddit

Will AI usage become dirt cheap eventually?

Currently, claude code with opus is quite expensive, and I force myself to structure everything in a way that I am optimising the context that Opus reads into. But will AI become eventually dirt ch...

skill
by thatmemeguy___ Mar 13, 2026 8/10
skill Reddit

Better pptx skill?

Hi everyone, Claude's default pptx skills isn't that great. For example, instead of adding text boxes in shapes, it will layer a text box above the shape. Because of this approach, whenever I move ...

skill
by ambitiousDepresso Mar 13, 2026 6/10
skill Reddit

Are skills worth it?

Hello, i'm still new to claude, i don't do anything challenging like coding or complex stuff, i only use it for the moment to generate documents, reports, and basically everyday ai stuff, is it wor...

skill
by Educational_Quiet_60 Mar 13, 2026 6/10
skill GitHub

web3-bounty-ai-skills: 18 Skill Files for Smart Contract Security From Real Hunt Data

Eighteen Claude Code skill files for smart contract security auditing, built from 2,749 Immunefi bug reports, 681 DeFiHack reproductions, and real hunting experience. A highly specialized set of skills for security researchers doing Web3 bug bounties.

web3securitysmart contractsbug bountyImmunefiDeFi
by shuvonsec Mar 13, 2026 7/10
skill Reddit

Launch Skill: 6 Battle-Tested Playbooks From 30+ Product Hunt #1 Launches

A Claude skill condensing launch knowledge from 30+ Product Hunt #1 finishes, 6,000+ GitHub stars in 7 days, and reach across 100+ countries. Structured as a full-lifecycle launch playbook to give Claude structured, non-generic launch guidance for AI products.

launchProduct Huntmarketingskillplaybook
by joackimreal Mar 13, 2026 6/10
skill Reddit

clarify-first: Open-Source Skill That Makes Agents Ask Before High-Risk Execution

An open-source skill called Clarify First that makes Claude Code stop and ask for clarification before executing ambiguous or high-risk requests. Addresses the premature execution failure mode — requests like "optimize this" or "deploy now" now trigger clarifying questions instead of immediate action.

safetyclarificationskillagent behaviorhigh-risk
by Entire_Home_983 Mar 13, 2026 7/10
skill Reddit

Bug Bounty Trilogy: Three Open-Source Repos Turning Claude Code Into a Full Hunting Co-Pilot

Three open-source repositories that turn Claude Code into a full web/web3 bug bounty co-pilot: recon and attack surface mapping, vulnerability scanning (IDOR, SSRF, XSS, SQLi, OAuth, GraphQL, race conditions, LLM injection), and report writing. Built to eliminate manual copy-pasting of context.

bug bountysecurityreconweb3skillhacking
by shuvon2005 Mar 13, 2026 7/10
skill GitHub

corporate-decision-panel: Multi-Perspective Business Analysis Skill With Engineered Dissent

A Claude Code skill that provides structured, multi-perspective business analysis by engineering deliberate disagreement. Instead of yes-man outputs, the skill presents opposing viewpoints and challenges assumptions, making it useful for high-stakes business decisions.

business analysisdecision-makingskillcorporatedissent
by apatheticus Mar 13, 2026 7/10
skill GitHub

ai-skills-manager: Team Tool for Creating, Testing, Distributing, and Managing AI Skills

A skills management system that enables team members to create, test, distribute, install, update, and remove skills from their projects and user space. Provides a structured lifecycle for AI skills in team environments, similar to a package manager but for Claude Code skills.

skillsteamdistributionmanagementlifecycle
by zncdata-labs Mar 13, 2026 7/10
skill GitHub

swift-security-skill: Skill for Secure Credential Storage and Cryptography on Apple Platforms

A Claude Code skill covering secure credential storage and cryptography on Apple platforms. Includes Keychain Services, biometric authentication, CryptoKit, and OWASP compliance patterns for iOS and macOS. Gives Claude Code agents proper security guidance for Apple platform development.

securitySwiftiOSmacOSKeychainOWASPCryptoKit
by ivan-magda Mar 13, 2026 7/10
skill GitHub

pr-review-skill: AI PR Review Pipeline That Cuts 30-45 Min Reviews to 8 Min

A Claude Code skill that creates a structured AI-powered PR review pipeline. Reduces typical 30-45 minute code reviews to under 8 minutes through a systematic, consistent review process that checks logic, style, security, and potential regressions.

PR reviewskillcode reviewefficiencypipeline
by junyoung2015 Mar 13, 2026 8/10
skill Reddit

B2B SaaS Growth Playbook as a Claude Skill: PMF, PLG, SLG, Channels, Partners

A Claude skill condensing real B2B SaaS growth patterns from companies like HeyGen, Deel, Vercel, and Supabase into a structured operator's handbook. Covers PMF validation, PLG/SLG strategy, affiliate programs, channel partnerships, and scaling metrics — less generic than typical AI growth advice.

B2BSaaSgrowthplaybookskillPMFPLG
by Shadow-Monarch015 Mar 13, 2026 6/10
skill Reddit

solid-audit: Claude Code Plugin to Audit and Fix SOLID Principle Violations

A Claude plugin that audits code for SOLID principle violations and suggests fixes. Supports Python, TypeScript, Java, Go, C#, Kotlin, Ruby, and PHP. Installable directly from the Claude Code marketplace with /plugin commands, then run /solid-audit to get a detailed report.

SOLIDcode qualityauditpluginrefactoring
by muthukrishnan749 Mar 13, 2026 7/10
skill GitHub

semantic-scholar-skills: S2-First Discovery Engine for AI Research Workflows

A Python library, set of Claude Code skills, and MCP server built around Semantic Scholar (S2) as the primary source for AI research discovery. Enables research workflows that search and retrieve academic papers directly from Claude Code.

researchSemantic ScholarMCPskillacademic papers
by zongmin-yu Mar 13, 2026 6/10
skill GitHub

health-skillz: Claude Skill for Personal Health Records via SMART on FHIR

A Claude Skill that connects to and analyzes personal health records using the SMART on FHIR standard. Enables Claude Code to query health data from FHIR-compatible sources, making it useful for health-focused development and personal health analytics.

healthFHIRmedical dataskillSMART
by jmandel Mar 13, 2026 6/10
skill GitHub

.agents: Production-Tested Agents, Skills, Commands, and Rules for AI Coding

A collection of agents, skills, commands, and rules for AI-powered coding tools used daily in production at Weaverse. These are real-world tested configurations that supercharge development productivity across multiple AI coding tools.

agentsskillscommandsrulesproduction
by Weaverse Mar 13, 2026 7/10
skill GitHub

appstore-details: Skill That Auto-Generates App Store Metadata From Xcode Project

A Claude Code skill that reads your Xcode project and generates complete App Store Connect metadata and In-App Purchase details ready to copy and paste. No manual data entry needed — the agent reads the project structure and produces all required fields.

XcodeApp StoreiOSskillmetadata
by DiNerdyYawdie Mar 13, 2026 6/10
skill GitHub

lenny-skills: 86 Essential Product Management Skills From Top Industry Leaders

A collection of 86 product management skills curated from top PM leaders, designed for PMs and founders to enhance their work with Claude's assistance. Covers frameworks, methodologies, and decision-making patterns used by leading product organizations.

product managementPMskillsfoundersframeworks
by TindanLawrence Mar 13, 2026 6/10
skill X

Anthropic Hackathon Winner Claude Code Optimal Settings — Video Breakdown (Japanese)

A Japanese YouTube video ("ゆっくり解説" narrated explainer style) that thoroughly analyzes the Claude Code settings configuration used by an Anthropic hackathon winner. While in Japanese, the settings themselves may be extractable and applicable for English speakers interested in high-performance Claude Code configurations.

settingsconfigurationhackathonbest-practicesCLAUDE.md
by @kenlog_net Mar 13, 2026 5/10
skill Reddit

Family Logistics Skill: Weekly Scheduling for Busy Households

A Claude Code skill built by a healthcare family to solve complex weekly logistics: who's home, who's cooking, who handles childcare and dogs across opposite schedules. An example of using Claude Code skills for personal automation beyond coding—scheduling, constraint solving, and family coordination.

skillautomationpersonalschedulinglogistics
by PerceptionOld8565 Mar 13, 2026 6/10
skill GitHub

claude-code-kit: Starter Templates That Make Claude Code Behave Like a Staff Engineer

Drop-in CLAUDE.md starter templates designed to constrain Claude Code into behaving like a disciplined staff engineer rather than an eager intern. Covers scope management, code ownership, review workflows, and communication style—immediately usable in any project.

claude.mdtemplatesworkflowbest-practicesstarter
by tansuasici Mar 13, 2026 8/10
skill Reddit

Hands-On Claude Skills Course: Build a Skill From Scratch Using Claude API as Evaluator

A 7-module browser-based interactive course that teaches Claude Skills by having you build a meeting-action-extractor skill from scratch. Uniquely uses the Claude API as the evaluation engine—it checks your skill files and gives contextual feedback on your code. A structured curriculum for learning skills development.

skillscourselearningclaude-apitutorial
by ScaryWatercress4560 Mar 13, 2026 7/10
skill Reddit

Simplest Guide to Building and Mastering Claude Skills

A clear guide explaining the three Claude primitives—Projects (knowledge base), Skills (instruction manuals), and MCP (tool connectivity)—and how to build skills from scratch. Explains when to use each, what belongs in a skill vs. a project, and how to structure SKILL.md files effectively.

skillstutorialguidemcpprojects
by HuckleberryEntire699 Mar 13, 2026 7/10
skill GitHub

claude-eureka: Claude Code Skills for ML/AI Researchers

A collection of Claude Code skills tailored for ML and AI researchers: experiment tracking, debugging model training runs, submitting jobs to SLURM clusters, and more. Fills a gap in the ecosystem for researchers who need AI coding assistance integrated with scientific computing workflows.

skillsmachine-learningresearchslurmexperiment-tracking
by Gaaaavin Mar 13, 2026 7/10
skill GitHub

brutal-honest-Skill: Ruthless Automated Code Review for 31+ Frameworks

A Claude Code skill that performs blunt, unfiltered automated code review across 31+ frameworks including game dev support. Features post-mortem verification and anti-AI-slop detection to catch the patterns AI agents commonly introduce. No sugar-coating—designed for developers who want honest feedback.

code-reviewskillanti-slopmulti-framework
by Gakuseei Mar 13, 2026 7/10
skill GitHub

kicad-happy: Claude Code Skills for KiCad Electronics Design

A set of Claude Code skills for KiCad electronics design workflows: analyze schematics, review PCB layouts, download datasheets, source components, and prepare boards for fabrication. Useful for hardware engineers using AI-assisted PCB design.

skillskicadelectronicspcbhardware
by aklofas Mar 13, 2026 6/10
skill Reddit

Claude Skill for Hallucination-Free Islamic Knowledge via Supabase RAG

A Claude Skill that prevents hallucination on Islamic texts by refusing to answer from model memory. Every query triggers a live lookup against a Supabase database of 20,972 authenticated records (Quran verses + Sahih Bukhari + Sahih Muslim hadiths). Demonstrates how skills can enforce strict grounding in external authoritative sources.

skillRAGSupabasehallucinationgrounding
by New_Brush3972 Mar 12, 2026 6/10
skill GitHub

AI Design Engineering Plugins: persona-driven concept-to-production guidance in Claude Code

A set of Claude Code plugins that use AI-driven design engineering personas to guide developers from initial concept through to production deployment. The personas provide structured guidance for building resilient agentic applications with consistent design patterns. Aims to make the full software development lifecycle more systematic when working with Claude Code.

pluginspersonasagenticdesignworkflow
by Yasas9029 Mar 12, 2026 5/10
skill GitHub

aws-agent-skills: AWS automation skills for Claude Code agents

A collection of Claude Code agent skills for AWS automation tasks, providing ready-to-use skill definitions for common AWS operations. Enables AI agents to interact with AWS services directly from a Claude Code session. Useful for teams building AWS-integrated workflows with Claude Code.

AWSskillscloudautomationagent
by itsmostafa Mar 12, 2026 5/10
skill GitHub

claude-code-starter: Beginner meta-documentation framework for vibe-coding with Claude Code

A starter template providing meta-documentation scaffolding for Claude Code projects, designed for beginners entering AI-assisted development. Includes foundational CLAUDE.md patterns and project structure tailored for vibe-coding practice. Good starting point for developers new to working with Claude Code on real projects.

starterCLAUDE.mdbeginnervibe-codingtemplate
by Redemptions7 Mar 12, 2026 5/10
skill Reddit

Shield: open-source Claude Code skill for SAST, secrets scanning, and dependency audit

Shield is a Claude Code skill that orchestrates multiple security scanners from a single /shield:shield command. It auto-detects your stack and runs Semgrep SAST, gitleaks secrets scanning, and npm/pip dependency audits, consolidating results into a unified report with a 0-100 risk score and OWASP/CWE/PCI-DSS compliance mapping. Found 103 secrets and 36 vulnerabilities in the author's own project, including AWS keys and a production .env tracked in git.

securitySASTsecretsvulnerabilityskillopen-sourcesemgrep
by alissonlinneker Mar 12, 2026 9/10
skill GitHub

CLAUDEmd: Multi-AI orchestration via CLAUDE.md with Auggie, Codex, and Gemini

A CLAUDE.md configuration framework that directs Claude to orchestrate context retrieval and analysis across multiple AI models including Auggie, Codex, and Gemini. Demonstrates how CLAUDE.md instructions can delegate specialized subtasks to different models for optimal results. Provides a template for teams wanting to build multi-model AI collaboration into their Claude Code workflow.

CLAUDE.mdmulti-agentorchestrationCodexGemini
by AnnsHarry Mar 12, 2026 5/10
skill GitHub

conclave: Skill That Makes Multiple LLMs Debate and Synthesize a Superior Answer

conclave is a Claude Code skill that pits multiple LLMs against each other: they debate and critique anonymously, then synthesize their best insights into a single, higher-quality answer. Useful for complex decisions where you want perspective beyond a single model's reasoning.

multi-llmdebatesynthesisskillquality
by tommasinigiovanni Mar 12, 2026 7/10
skill Reddit

Superpowers-Optimized Fork: 73% Fewer Tokens With Automatic Routing and Safety Hooks

A research-backed fork of the popular Superpowers plugin that adds automatic task routing, specialist reviewer skills for complex changes, and safety hooks, while maintaining the same workflow. Achieves 73% fewer tokens through smarter routing rather than reduced capabilities. Drop-in replacement.

optimizationtokensroutingsafetyskillsfork
by Double_Seesaw881 Mar 12, 2026 7/10
skill GitHub

xpull: Agent Skill to Pull Tweets and Threads From X Without Login or API Keys

xpull is an agent skill that allows Claude Code to fetch tweets, threads, and articles from X/Twitter without authentication or API keys. Useful for research and content aggregation workflows that need to pull social content programmatically.

xtwitterscrapingskillresearch
by sanjeevneo Mar 12, 2026 7/10
skill Reddit

Jetpack Compose Agent Skill: Up-to-Date Android Compose API Knowledge for Claude Code

A skill that injects current Jetpack Compose API knowledge into Claude Code, addressing the problem of outdated or hallucinated Android UI code. Keeps the agent's Compose knowledge current without relying on training data that may be months behind the latest APIs.

androidjetpack-composekotlinskillup-to-date
by anhvt Mar 12, 2026 6/10
skill Reddit

Startup Idea Validator: Claude Skill That Stress-Tests Ideas Before You Write Code

A Claude skill that runs a structured validation process on startup ideas — identifying customer discovery gaps, competitive landscape, and likely failure modes — before any code is written. The developer says it would have saved them 3 months of building something nobody wanted.

startupvalidationideationskillproduct
by ferdbons Mar 12, 2026 6/10
skill GitHub

LibreOffice-skills: Deterministic Python Skill Suite for LibreOffice Automation

A Python-based skill suite for controlling LibreOffice with AI agents in a deterministic way. Enables Claude Code to create, edit, and manipulate LibreOffice documents, spreadsheets, and presentations with predictable, reproducible outcomes.

libreofficepythonofficeautomationskill
by dfk1352 Mar 12, 2026 6/10
skill X

Three Categories of Claude Skills Worth Building: Documents, Workflows, MCP Enhancement

A practical taxonomy for deciding which Claude skills are worth building: document/asset creation (reports, designs, code), workflow automation (multi-step processes), and MCP enhancement (teaching Claude how to use connected tools well). Helps prioritize skill development efforts.

skillstaxonomyworkflowmcpstrategy
by @gudanglifehack Mar 12, 2026 6/10
skill Reddit

aise: Claude Code Self-Improvement Tool That Learns From Repeated Mistake Patterns

aise tracks mistakes Claude Code makes across sessions and identifies patterns — mistakes that occur repeatedly are extracted and added to CLAUDE.md as prevention rules. Unlike manually updating CLAUDE.md after each incident, aise automates the pattern recognition step and generates targeted, minimal instructions to prevent recurrence.

CLAUDE.mdself-improvementmistakespatternsautomation
by doomdayx Mar 12, 2026 8/10
skill Reddit

Stop Over-Engineering Your CLAUDE.md — Let Claude Build It As You Work

Instead of pre-designing a complex CLAUDE.md structure, this post argues for letting Claude build and evolve it incrementally as you work through real tasks. The author has seen better results from CLAUDE.md files shaped by actual usage patterns than from elaborate up-front structures, and shares the workflow for guiding Claude to maintain it.

CLAUDE.mdworkflowbest-practicesincremental
by PawelHuryn Mar 12, 2026 8/10
skill GitHub

skill-manager: Auto-Detect and Disable Irrelevant Claude Code Skills Per Project

skill-manager analyzes your active project to determine which installed Claude Code skills are relevant and automatically disables the rest for that session. Reduces token overhead from irrelevant skill schemas loading into context and keeps tool selection focused on what the current project actually needs.

skilltoken-savingscontextproject-scopedautomation
by mrdenox109-nyx Mar 12, 2026 8/10
skill Reddit

Open-Source Library of 181 Agent Skills — Seeking Community Feedback on Gaps

A developer maintaining an open-source library of 181 Claude agent skills is asking the community what is missing. The library covers the full development lifecycle and is publicly available for contribution. Good resource for discovering battle-tested skills and for contributing new ones to fill gaps.

skilllibraryopen-sourcecommunitycollection
by nginity Mar 12, 2026 8/10
skill X

SkillsMP: A Marketplace With 200,000+ Agent Skills for Claude Code

SkillsMP is described as an App Store for AI agent skills — a marketplace of over 200,000 skills designed for Claude Code that extend what the agent can do beyond text and code generation. Skills cover integrations, workflows, domain expertise, and tooling. The most downloaded skill is a notification hook for task completion.

marketplaceskillscommunityextensions
by @Suryanshti777 Mar 12, 2026 8/10
skill Reddit

CC v2.1.74: New System Prompts Add +1750 Tokens — Title Generator, /stuck Skill, Memory Selection

Claude Code v2.1.74 shipped notable system prompt additions including a session title generator, a /stuck skill to diagnose frozen sessions, and an improved memory selection agent prompt. The changelog post breaks down each new prompt with the full text, useful for understanding how Claude Code uses its own built-in skills.

changelogsystem-promptskillsmemorystuck
by Dramatic_Squash_3502 Mar 12, 2026 8/10
skill Reddit

SKILL.md Linter That Catches Silent Cross-Agent Validation Failures

Skills that loaded fine in Claude Code silently failed in VS Code because the name field did not match the parent directory — a rule Claude Code does not enforce but VS Code does. This linter catches that class of cross-agent inconsistency and other SKILL.md structural issues before they cause hard-to-debug failures.

skilllintervalidationSKILL.mdcross-agent
by BradKinnard Mar 12, 2026 8/10
skill GitHub

antigravity-awesome-skills: 1000+ Agentic Skills for Claude Code, Cursor, and Antigravity

A curated collection of over 1000 battle-tested SKILL.md files for Claude Code, Antigravity, and Cursor — including official skills from Anthropic and Vercel. Covers the full development lifecycle from planning and coding to deployment, testing, and specialised domains.

skillcollectionanthropicvercelantigravitycursor
by sickn33 Mar 12, 2026 9/10
skill GitHub

Structured Prompt Engineering Skill With 300+ Curated Examples

Structured prompt engineering library and Claude Code skill featuring 300+ curated examples for writing effective AI prompts. Helps produce high-quality, precise prompts for Claude Code agents and downstream tasks.

prompt engineeringexampleslibrarytemplatesskill
by Marwane83930 Mar 12, 2026 6/10
skill GitHub

Meridian: Zero-Config Tasks, Memory, and Rules for Claude Code

Zero-config setup for Claude Code that provides tasks, memory, and rules for predictable interactions without changes to your chat config. Designed to work out of the box without any configuration required.

tasksmemoryruleszero-configsetup
by adamwac2515 Mar 12, 2026 7/10
skill Reddit

PlanKit: Lightweight In-Repo Planning Plugin for Claude Code

Claude Code plugin for in-repo project planning with four levels: Ideas, Roadmap, Steps, and Done. Each project gets its own planning folder committed to git. Claude reads your ideas, investigates the codebase, and asks targeted questions before proposing anything — no external tools or subscriptions.

planningproject managementpluginindie dev
by Jeehut Mar 12, 2026 7/10
skill X

Claude Code Agent Skills Internals: Setup, Folder Structure, and Demos

A detailed study session article explaining Claude Code Agent Skills: the overview and folder structure for customizing Claude Code behavior, setup walkthroughs, usage tips, and hands-on demo content. Good reference for teams learning to build custom Skills.

skillsagent-skillstutorialfolder-structureextension
by @topickapp_com Mar 11, 2026 5/10
skill Reddit

/discuss: Read-Only Discussion Mode Skill for Claude Code

A 25-line custom skill that puts Claude Code into a hands-off conversation mode—reads files, searches code, and does web lookups, but blocks all file modifications. Ideal for architecture discussions, codebase exploration, and thinking out loud without triggering unwanted edits.

skillslash-commandread-onlydiscussionexploration
by After_Book_7030 Mar 11, 2026 8/10
skill GitHub

claude-powers: 3-Layer Memory Architecture + Skills + Hooks + MCP for Claude Code

An OpenClaw + Claude Code superpowers system implementing three-tier persistent memory alongside Skills, Hooks, and MCP integration. Addresses context loss between sessions by building long-term memory that persists across conversations.

memoryhooksmcpskillspersistencecross-session
by TheSoulGiver Mar 11, 2026 8/10
skill GitHub

strangler_fig_newton: Claude Code Plugin for Migrating Monoliths to Microservices

Claude Code plugin that automates the Strangler Fig pattern for systematically migrating legacy monolithic codebases to microservices. Inspired by Martin Fowler's methodology and Obra Superpowers for incremental, low-risk extraction.

refactoringmicroservicesmigrationpluginarchitecture
by mhosner Mar 11, 2026 7/10
skill GitHub

smart-ralph: Spec-Driven Development with Smart Compaction for Claude Code

Claude Code plugin combining the Ralph Wiggum specification loop with structured spec-driven development and smart context compaction. Keeps agent sessions focused and grounded with persistent specification files that survive context resets.

spec-drivencompactionpluginralphworkflow
by tzachbon Mar 11, 2026 7/10
skill Reddit

Model Bake-Off: Haiku vs Sonnet vs Opus Performance on Claude Code Skills

Benchmark evaluation comparing Claude Haiku, Sonnet, and Opus on skill execution in Claude Code. Notable finding: Haiku performs surprisingly well with well-written skill content, narrowing the gap with larger models. Methodology and results posted on tessl.io.

haikusonnetopusbenchmarkskillsevaluation
by sjmaple Mar 11, 2026 7/10
skill GitHub

agent-skills: Official PowerSync Agent Skills for Claude Code

Official collection of Claude Code agent skills from the PowerSync team. Provides ready-to-use skills for integrating PowerSync real-time sync capabilities, database operations, and offline-first patterns into Claude Code workflows.

powersyncsyncdatabaseskillsofficial
by powersync-ja Mar 11, 2026 6/10
skill Reddit

Turbo: 28 Modular Skills for Automated Testing, Review, and Self-Improvement

Skill set that automates the full cycle after implementation: write missing tests, run multi-agent code simplification, trigger Codex peer review, commit with clean messages, and create/update PRs. The /self-improve skill routes lessons from conversation corrections into CLAUDE.md or memory files so Claude improves per-project over time.

skillstestingreviewself-improvingcommitprautomation
by Caibot Mar 11, 2026 8/10
skill Reddit

Agensi: Marketplace for SKILL.md Files with Security Scanning

Marketplace for buying and selling Claude Code SKILL.md files. Skills go through automated security scans (dangerous commands, secret detection, prompt injection). Creators keep 80% of revenue. After two weeks: 300-500 daily visitors, 100 users, 12 skills, 98 downloads.

marketplaceskillssecurityskill.mdcommunitymonetization
by BadMenFinance Mar 11, 2026 7/10
skill Reddit

Superpowers Brainstorming Skill Now Spins Up Interactive UI Mockup Web Server

Discovery that the Superpowers brainstorming skill now serves live UI mockup options via a local web server, letting you click to select a design before returning to the terminal. Invoked via /brainstorming or /superpowers:brainstorming.

superpowersbrainstorminguimockupskillinteractive
by oddslol Mar 11, 2026 5/10
skill GitHub

tikhub_api_skill: Call TikHub APIs Across 12+ Social Media Platforms

Claude Code agent skill that discovers and calls TikHub API endpoints across 12+ social media platforms (TikTok, Instagram, YouTube, etc.). Lets agents fetch content, metadata, and analytics from social platforms during coding sessions.

tiktoksocial-mediaapiskilltikhub
by tiendatne2004 Mar 11, 2026 5/10
skill GitHub

ai-agents-skills: Collection of Coding Assistance Skills for AI Agents

Curated collection of Claude Code skills for improved coding assistance, covering production-ready code generation, debugging patterns, and review workflows. Designed for efficient, high-quality agent outputs.

skillscodingcollectionproductivity
by Makiya1202 Mar 11, 2026 5/10
skill GitHub

agent-skills-cli: Install from 50,000+ Agent Skills with One Command

CLI tool for discovering and installing agent skills for Claude Code from a registry of 50,000+ skills. Single-command skill search and installation streamlines onboarding new capabilities into your workflow.

cliskillsregistryinstalldiscovery
by stbarbe Mar 11, 2026 7/10
skill GitHub

claude-react-kit: Claude Code Config to Enforce Clean Architecture in React

Drop-in Claude Code configuration for React projects that enforces clean architecture patterns and prevents technical debt accumulation. Manages context budgets and import conventions to keep large React codebases navigable for agents.

reactarchitectureclaude.mdconfigtechnical-debt
by wahmoh Mar 11, 2026 6/10
skill GitHub

creative-director-skill: Generate and Score Advertising Concepts with AI

Claude Code skill that generates advertising concepts, scores them against industry-standard creative director criteria, and iterates using proven creative methodologies. Useful for marketing teams using Claude Code to ideate campaigns.

marketingadvertisingcreativeskillideation
by eiwru Mar 11, 2026 5/10
skill GitHub

PapersFlow Research Skills: Literature Search and Citation Graphs via MCP

Reusable Claude Code skills for academic research workflows — literature search, citation graph exploration, and DeepScan monitoring, all powered by the papersflow-mcp server. Combines the Claude Code skills system with MCP for a domain-specific research assistant pipeline.

skillmcpresearchacademicliterature
by papersflow-ai Mar 11, 2026 6/10
skill X

Organizing ~/.claude/ for Skills, Sub-Agents, and Shared Scripts

A developer shares their ~/.claude/ directory structure for managing Claude Code skills, custom slash commands, and shared shell scripts. The layout separates scripts/ (executable by agents), commands/ (slash commands), and CLAUDE.md (global config) for a clean, maintainable setup.

skillsub-agentorganizationCLAUDE.mdscriptsconfig
by @sho_tewodou Mar 11, 2026 7/10
skill GitHub

golang-skills: Modular AI-Driven Go Lessons as Claude Code Skills

A collection of Claude Code skills for Go programming, covering best practices, code reviews, concurrency patterns, and data structures. Each lesson is modular and AI-driven, making it easy to apply specific Go knowledge directly in your coding sessions.

golangskillscode-reviewconcurrencylearning
by dwana1 Mar 11, 2026 5/10
skill X

Complete Guide to Claude Code Skills: Foundations, Architecture, Testing, and Production

A single article covering the full lifecycle of building Claude Code skills — from foundational concepts and architectural patterns to testing strategies and production deployment. Aims to give developers everything needed to build skills that automate workflows and boost productivity.

skillsguidearchitecturetestingproduction
by @hooeem Mar 11, 2026 7/10
skill GitHub

financial-analyzer-lite: Free Stock Analysis Skill for Claude via yfinance

A Claude skill that pulls live stock data using yfinance and produces structured valuation and financial health analysis for any ticker. No paid API keys required — just install the skill and ask Claude to analyze a stock. Good starting point for custom financial research workflows.

skillfinancestocksyfinanceanalysisdata
by apex-stack-ai Mar 11, 2026 5/10
skill GitHub

shirman-digest: Automated AI & Tech Trends Digest Skill for Claude Code

A Claude Code skill that automates fetching and summarizing AI and tech news from shir-man.com into a structured digest. Useful as a template for building your own automated content aggregation skills within Claude Code workflows.

skilldigestautomationnewsai-trendscontent
by jojoprison Mar 11, 2026 5/10
skill GitHub

pseo-auditor-lite: Free Programmatic SEO Audit Skill for Claude

A Claude skill that audits programmatic SEO implementations — analyzing page templates, crawl budget allocation, and indexing health. Useful for developers and SEO practitioners who want AI-assisted analysis of large-scale content sites without manual tooling setup.

skillseoauditprogrammatic-seoweb
by apex-stack-ai Mar 11, 2026 5/10
skill Reddit

How do you find value with the Max subscription fees?

Genuine question as someone who has recently moved over from ChatGPT and never really saw the need to pay $200/month for it. Loving Claude so far and skills/Cowork has been a revelation for me give...

skill
by AnusMcBumhole Mar 11, 2026 6/10
skill Reddit

Repeatative tasks in co-work

What’s the best way to perform repetitive tasks in co-work? I have list of few accounts, that co-work researches following guides from the skills. But as expected after 4-5 accounts, the quality dr...

skillapi
by Visible_Resource9503 Mar 11, 2026 6/10
skill Reddit

Claude getting sloppy as I do more work. Anyone else?

I am an average excel user with little coding experience. I switched to Claude because I read so much about how it was better at coding than ChatGPT. At first it was great. It walked me through Pow...

skill
by Odd_Bad5188 Mar 11, 2026 6/10
skill Reddit

Implement a Skill if the design is already as per my liking?

I've been building my first mobile app via Claude(demo app to understand CC). Today the weekly limit would be reset. I wanna know if I need to implement a skill or not. At the beginning, I asked it...

skill
by Working_Question4361 Mar 11, 2026 7/10
skill Reddit

When do you create Agents vs Skills?

I’ve mainly created skills and not agents and I haven’t come across a concrete difference that makes it worthwhile to launch the other because I’ve found subagents go off the rails and do the wrong...

skill
by doomdayx Mar 11, 2026 6/10
skill Reddit

How to let Claude Code watch youtube video

I heard supposedly Gemini is the only AI that can watch youtube video right now, is that still the case, and if so is there claude code skill to enable that or do I simply load the Gemini model or ...

skillworkflow
by maraluke Mar 11, 2026 8/10
skill Reddit

Did CC lose all it's memory today?

Been dealing with this over multiple sessions today, but it doesn't seem like sessions start with the correct context? like claude.md skills.md etc. arent' loading into context and it just forms a ...

skillclaude.md
by monkey_spunk_ Mar 11, 2026 8/10
skill Reddit

Skill.md Git repositories or Gist to share?

Our friendly friend Claude suggested me to share my Shipping label printer skill for cropping down labels and printing them, just by telling that you added folders to a file that have shipping labe...

skillgit
by SunofaBaker Mar 11, 2026 6/10
skill Reddit

Projects / Cowork / Code

I feel unsure about which Claude module to use for my daily work working in finance. I find myself wanting and trying to build README files for agents that I want to use for my daily, weekly, month...

skill
by AIfinance123 Mar 11, 2026 7/10
skill Reddit

Improved version of systematic-debugging skill

Spent some time developing an improved version of the systematic-debugging skill for claude code. Might be helpful for some! https://github.com/pytholic/claude-skills/tree/main/systematic-debugging...

skillgittesting
by rajahaseeb147 Mar 11, 2026 9/10
skill Reddit

Whats your claude code "setup"?

How do you use your Claude Code? WHY you think your way is the best? Do you use it only in the terminal? Do you use it together with an IDE? If you have an IDE, which and why, and does it matter? D...

skill
by AerieAcrobatic1248 Mar 11, 2026 10/10
skill Reddit

Good PR review prompt?

Hey, can anyone share a working prompt for a PR review? I want to create a skill that receives a branch name and reviews it according to specific steps. The problem I’m seeing is that the agent som...

skillreview
by NO2UT Mar 11, 2026 6/10
skill GitHub

x402-payments-skill: Build Paid APIs on Base & Solana With USDC

The most comprehensive x402 payments skill for AI coding agents, enabling Claude Code to build paid APIs on Base and Solana with USDC. Includes a Sentinel Payment Router for agent-to-agent commerce. Targets the emerging agentic commerce ecosystem.

skillpaymentsx402cryptoagentic-commercesolana
by valeo-cash Mar 11, 2026 6/10
skill Reddit

8 Claude Code Plugins for Agentic Commerce (UCP, ACP, Stripe, x402)

A suite of 8 Claude Code plugins covering agentic web protocols: UCP (REST/A2A), ACP (Stripe delegated payments), AP2 (crypto signing), and A2A (agent task delegation). Acts as an expert co-developer for building agents that shop, pay, and negotiate autonomously.

pluginspaymentsagentic-commerceprotocolsa2a
by NoAide1608 Mar 11, 2026 7/10
skill GitHub

claude-skill-prompt-architect: Transform Vague Prompts Using 7 Frameworks

A Claude Code skill that rewrites vague prompts into structured, expert-level prompts using 7 research-backed frameworks: CO-STAR, RISEN, RISE, TIDD-EC, RTF, Chain of Thought, and Chain of Density. Helps get consistently better results from Claude by improving prompt structure automatically.

skillprompt-engineeringco-starrisenframeworks
by ckelsoe Mar 11, 2026 7/10
skill GitHub

dagster-io/skills: Official AI Skills for Working With Dagster

Official AI skills from the Dagster team for working with their data orchestration platform. Provides Claude Code with deep knowledge of Dagster patterns, assets, jobs, and best practices. Useful for data engineers who use both Dagster and Claude Code.

skilldagsterdata-engineeringorchestrationofficial
by dagster-io Mar 11, 2026 6/10
skill GitHub

Anthropic-Cybersecurity-Skills: 611+ Security Skills for AI Agents

A comprehensive collection of 611+ cybersecurity skills following the agentskills.io open standard, compatible with Claude Code, GitHub Copilot, Codex CLI, Cursor, and Gemini CLI. Covers vulnerability assessment, secure coding patterns, and threat modeling for AI-assisted security work.

skillsecuritycybersecurityvulnerabilityagentskills
by mukul975 Mar 11, 2026 7/10
skill GitHub

tech-leads-club/agent-skills: Secure, Validated Skill Registry for AI Agents

A security-focused, validated skill registry for professional AI coding agents. Skills are vetted before inclusion, making it safer to adopt community skills. Extends Claude Code, Cursor, Copilot, and Antigravity with confidence in what you're running.

skillregistrysecurityvalidatedprofessional
by tech-leads-club Mar 11, 2026 7/10
skill GitHub

NASA PDS Claude Code Skills: Automated Release Notes and Status Reports

Official Claude Code skills from NASA's Planetary Data System (PDS) team for automating release notes, program status reports, and other NASA PDS-specific workflows. An interesting example of a major scientific organization adopting Claude Code skills for technical automation.

skillnasaautomationrelease-notesscientific
by NASA-PDS Mar 11, 2026 6/10
skill GitHub

Research Pipeline Skills: Semantic Execution Units with Evidence-First Methodology

Skills that structure research pipelines as semantic execution units — each declares inputs, outputs, acceptance criteria, and guardrails. Prevents hollow AI writing through structured intermediate artifacts and an evidence-first approach.

researchpipelineevidencestructuredwriting
by WILLOSCAR Mar 10, 2026 6/10
skill GitHub

Personal Plugin Marketplace Config for Claude Code (bendrucker)

A personal collection of Claude Code plugins and global settings curated by a developer. Useful as a reference for structuring your own plugin registry and discovering community-tested Claude Code configurations.

pluginsconfigmarketplacesettingsreference
by bendrucker Mar 10, 2026 5/10
skill GitHub

claude-config: Sync Claude Code Global Settings Across Machines

A tool to sync and manage Claude Code global and home-level settings across multiple machines. Useful for developers working on several computers who want consistent Claude Code configurations everywhere.

configsyncsettingsmulti-machinedotfiles
by WoojinAhn Mar 10, 2026 6/10
skill GitHub

B2B SaaS Marketing Skills for Claude Code and Cursor Agents

A collection of B2B SaaS marketing skills compatible with SKILL.md format, usable in Claude Code, Cursor, and other AI agents. Covers marketing workflows that non-developers can run directly from the terminal.

marketingb2bsaasskillscursor
by Stallin-Sanamandra Mar 10, 2026 5/10
skill Reddit

uberSKILLS: Open-Source IDE for Creating, Testing, and Deploying Claude Skills

A web-based IDE specifically for building SKILL.md files. Features AI-assisted creation from natural language, a structured editor with real-time validation, multi-model testing via OpenRouter, one-click deployment to Claude Code, version history, and bulk import/export. Start with a single npx command, no Docker needed.

skillsidetestingdeploymentopen-sourceskill.md
by felltrifortence Mar 10, 2026 9/10
skill Reddit

claude-skills-founder: 12 Startup Strategy Skills for Claude Code

A skills pack for startup founders — not developers. Includes /validate-idea, /competitor-matrix, /mvp-scope, /pricing-strategy, /go-to-market, /pitch-deck, /fundraise-prep, and more. Drop the commands/ folder into .claude/commands/founder/ and run from your terminal. MIT licensed.

skillsstartupfounderstrategyproductpitch
by akorecebov Mar 10, 2026 8/10
skill Reddit

skillfile: Declarative Package Manager for AI Skills and Subagents

A CLI that reads a single config file and handles fetching, locking, and deploying skills and agents — like Brewfile or package.json, but for AI tool definitions. Supports local customizations via patch files that survive upstream updates. Install with cargo install skillfile.

skillspackage-managerdeclarativeagentsrustlocking
by julennnnn Mar 10, 2026 8/10
skill Reddit

70+ Claude Code Skills for the Full Product Manager Workflow

A comprehensive PM skill library built by a 20-year PM: /prd-generator, /user-interview-analyzer, /competitive-profile-builder, /roadmap-builder, /weekly-metrics, /win-loss-analysis, /experiment-designer, and 60+ more. Covers go-to-market, pricing, OKRs, stakeholder updates, and decision frameworks. Browse free at mysecond.ai/skills.

skillsproduct-managerworkflowprdroadmapokr
by Which-Objective2553 Mar 10, 2026 8/10
skill GitHub

auto-skill: Self-Evolving Memory System that Captures and Reuses Agent Knowledge

Automatically captures, indexes, and reuses knowledge from AI agent interactions to build a self-evolving, memory-driven assistant system. Skills improve over time as the agent learns from past work rather than starting fresh each session.

memoryknowledgeself-evolvingindexingagentlearning
by Chocoberry1108 Mar 10, 2026 6/10
skill GitHub

InfraNodus Skills: Augment LLM Thinking with Knowledge Graph Insights

Skills integrated with InfraNodus, a knowledge graph visualization tool, to augment the LLM thinking process. Adds structural reasoning and graph-based insight generation on top of standard language model capabilities.

skillsknowledge-graphthinkingreasoninginfranodus
by infranodus Mar 10, 2026 5/10
skill X

Plug-and-play CLAUDE.md template from Claude Code creator Boris Cherny's workflow

A ready-to-use CLAUDE.md template derived from Anthropic's internal workflow as shared by Boris Cherny, the creator of Claude Code. Dropping this file in a repo reportedly makes Claude Code significantly more effective. An excellent starting point for anyone wanting to configure Claude Code using proven best practices.

claude-mdconfigurationbest-practicesboris-chernyanthropicworkflow
by @DAIEvolutionHub Mar 10, 2026 9/10
skill X

Smart contract audit workflow: /solidity-auditor skill + Claude Code Foundry PoC generation

A security audit workflow combining a custom /solidity-auditor slash command with Claude Code to triage findings and auto-generate Foundry mainnet fork proof-of-concept tests. Claude Code handles building the test files and run commands, reducing repetitive grunt work for Solidity developers.

soliditysecurityauditfoundrysmart-contractscustom-command
by @Harvesto12 Mar 10, 2026 6/10
skill Reddit

PromptVault: CLI to sync CLAUDE.md / AGENTS.md across projects

Proposes PromptVault, a CLI tool to version and synchronize AI agent configuration files (CLAUDE.md, AGENTS.md, .cursorrules) across projects. Solves duplicated and conflicting instructions between tools. Seeking community validation before building as open-source.

CLAUDE.mdpromptsconfigCLIproject-management
by DaherSystemsAndIA Mar 10, 2026 7/10
skill GitHub

Claude Code Skill: PDF-to-Markdown Extraction and Paper Reproduction

A Claude Code skill for full-fidelity PDF-to-Markdown conversion, Python-based reproduction of research paper experiments, and bilingual README generation with embedded figures. Designed for academic and ML research workflows where reproducing paper results is a common task.

skillpdfmarkdownresearchpythonacademic
by celynnmoonlight Mar 10, 2026 6/10
skill GitHub

Agent Skills for Context Engineering in AI Agents

A set of skills designed to help AI agents manage and optimize context window usage. Covers techniques for efficient information handling, context prioritization, and performance optimization. Intended to enhance agent systems that rely on skill-based context injection.

skillcontext-engineeringagentoptimization
by Kalyanikhandare29 Mar 10, 2026 5/10
skill GitHub

GTM Engineering Skills for Claude Code (Powered by Deepline)

A collection of Claude Code skills for go-to-market engineering tasks: B2B prospecting, lead enrichment, signal discovery, and lead generation powered by Deepline. Useful for sales and marketing teams automating outbound workflows with Claude Code.

skillgtmsalesprospectinglead-generationdeepline
by getaero-io Mar 10, 2026 6/10
skill GitHub

codeworth: Estimate the Real Cost to Rebuild Any Codebase From Scratch

A Claude Code skill that estimates codebase rebuild cost across 5 dimensions: domain knowledge, infrastructure coupling, data model depth, integration surface, and operational maturity. Goes beyond lines-of-code to capture true complexity.

skillestimationcodebasecomplexityanalysis
by teterouge Mar 10, 2026 7/10
skill GitHub

email-triage: Gmail Inbox Triage Agent Skill

A Claude agent skill that scans your Gmail inbox, classifies every message using your own rules, applies Gmail labels, and archives suspected junk. A complete autonomous email management workflow requiring only rule configuration.

skillgmailemailautomationtriage
by sskaye Mar 10, 2026 7/10
skill Reddit

Google Ads Bulk Upload Skill That Fixes Silent CSV Failures

A 730-line instruction file that eliminates Google Ads Editor import failures. Seven modules cover exact column headers per row type, encoding rules (em dashes and smart quotes that silently corrupt CSVs), policy compliance, and ad format validation. Eliminates the 'Ambiguous row type' import error.

skillgoogle-adscsvautomationmarketing
by fakereal-realfake Mar 10, 2026 6/10
skill GitHub

awesome-agent-skills: 500+ Agent Skills From Official Dev Teams

A curated collection of 500+ agent skills from official development teams and the community, compatible with Claude Code, Codex, AntiGravity, Gemini CLI, and Cursor. Central resource for the growing skills ecosystem.

skillcollectioncommunitycurated
by VoltAgent Mar 10, 2026 7/10
skill GitHub

claude-code-workflow: BDD/TDD Skill and Code Review Hooks

A Claude Code development workflow template featuring a BDD/TDD skill and code review hooks for autonomous feature development. Enforces test-first practices and automated code quality gates.

skillhooktddbddcode-reviewworkflow
by zxkane Mar 10, 2026 7/10
skill Reddit

YouTube Video to Markdown Notes Skill

A Claude skill that takes a YouTube video URL and outputs a structured Markdown note with title, channel, description, chapters, transcript, and YAML frontmatter. One command, no API keys needed.

skillyoutubemarkdownnotestranscription
by JimmySadek Mar 10, 2026 7/10
skill GitHub

academic-research-skills: Full Research Workflow for Claude Code

A skill collection covering the full academic research pipeline: research, write, review, revise, and finalize. Enables Claude Code to handle complete research document workflows autonomously.

skillresearchacademicwritingworkflow
by Imbad0202 Mar 10, 2026 6/10
skill Reddit

master-plan: ADHD-Friendly Task System Built Into Your Terminal

A Claude Code plugin with four commands designed for non-linear thinkers: /task for quick brain dumps, /next for priority-scored task picking with in-progress highlighting, /save for WIP commits, and /done for test-run-commit. Built on markdown and git, zero infrastructure.

skilltask-managementproductivitygitadhd
by Endlesssky27 Mar 10, 2026 7/10
skill Reddit

Screenshot Websites Without Opening a Browser — Claude Skill

A Claude skill using the Zyte API to take screenshots and extract content from websites without launching a browser. Handles bot detection, bans, and CAPTCHAs transparently.

skillscreenshotweb-scrapingzyteheadless
by cli_ninja Mar 10, 2026 7/10
skill Reddit

Multi-Wave Competitive Intelligence Skill With Parallel Agents

A structured competitive analysis skill running three sequential waves with parallel agents: competitor profiling and pricing intelligence, customer sentiment mining from review platforms and communities, and strategic synthesis. Extracts real signal — pricing psychology, G2 complaints, hiring signals — not just company names.

skillcompetitive-analysismulti-agentresearchbusiness
by ferdbons Mar 10, 2026 8/10
skill Reddit

AI Security Guide: 16 Prompt Injection Techniques + Testing Skill

A defense-in-depth guide for public AI chatbots covering input sanitization, rate limiting, zero-trust system prompt design, output controls, and cost caps. Includes a Claude Code skill that automatically tests all 16 prompt injection techniques against your chatbot.

skillsecurityprompt-injectiontestingdefense
by renatoworks Mar 10, 2026 7/10
skill GitHub

claude-skills: 7 Professional Toolkits for Claude Code

A complete Claude Code skill collection with seven professional toolkits covering project management, design, documents, analytics, knowledge management, repository operations, and multi-AI coordination.

skillcollectionprofessionalpmdesignanalytics
by LeoLin990405 Mar 10, 2026 7/10
skill GitHub

e2e-test-skills: Find 13 Anti-Patterns in E2E Tests

A Claude Code skill that detects error swallowing, boolean traps, always-passing assertions, and 10 other E2E test anti-patterns. Helps identify flaky or misleading tests that pass but provide no real coverage.

skilltestinge2eanti-patternsquality
by dididy Mar 10, 2026 8/10
skill GitHub

hypr-video-cli: Natural Language to MP4 Videos From Your Terminal

A Claude Code skill that renders MP4 videos from natural language descriptions using npx. Supports animations, transitions, captions, and 50+ effects entirely from the terminal.

skillvideomedia-generationclianimations
by superyhee Mar 10, 2026 7/10
skill GitHub

claude-wizard: 8-Phase Dev Skill With TDD and Adversarial Review

A Claude Code skill that turns the agent into a senior software architect through an 8-phase development cycle including TDD, adversarial code review, and quality gate checks before proceeding to the next phase.

skilltddcode-reviewquality-gatesarchitecture
by vlad-ko Mar 10, 2026 7/10
skill GitHub

Vskill — Secure Multi-Platform AI Skill Installer with Pre-Install Scanning

A skill installer that scans skills for security issues before installing them, covering 49 agents, 12 plugins, and 41 expert skills across multiple AI platforms. Addresses the trust problem of installing third-party skills without knowing what they do.

skillssecurityinstallerscanningtrustmulti-platform
Mar 10, 2026 8/10
skill GitHub

NOX — 33 Skills + 8 Agents + 19 Hooks for Claude Code, Gemini CLI, and Codex CLI

A single-install skill/agent/hook pack that works across Claude Code, Gemini CLI, and Codex CLI with zero configuration. Includes 33 skills, 8 agents, and 19 hooks — one of the most complete cross-platform AI coding skill packs available.

skillshooksagentsgemini-clicodex-clicross-platformzero-config
Mar 10, 2026 9/10
skill GitHub

Claude Code Skillforge — Generate, Upgrade, and Scan Skills with Live Best Practices Sync

A meta-skill that builds, upgrades, and scans other Claude Code and Antigravity SKILL.md files. Features live best-practices sync, marketplace search, skill upgrader, skill scanner, and self-validation. Essentially a skill management system that keeps your skills current automatically.

skillsskill-managementskill-mdbest-practicesself-improvingmarketplace
Mar 10, 2026 9/10
skill Reddit

Claude Code 2.1.72 System Prompt Changes — Auto Mode, Brief Mode, Worktree Tools

A detailed breakdown of +1,643 token changes in Claude Code 2.1.72 system prompts: new Auto mode (continuous background execution), Brief mode (Codex-like short status updates), ExitWorktree tool, and a second ToolSearch description. Several consolidated and removed guidance sections as well.

system-promptauto-modebrief-modeworktreechangelogtoolsearch
Mar 10, 2026 8/10
skill GitHub

UnseveredMemory — Markdown-Based Context Persistence for Claude Code Sessions

A memory retention system for Claude Code that uses structured markdown files to persist context across sessions. Ensures that knowledge from past sessions survives compaction and new session starts without relying on external databases.

memorycontext-persistencemarkdownsessionscontinuity
Mar 10, 2026 8/10
skill GitHub

Claude Code Best Practices — Community-Driven Reference Site

A Next.js + Fumadocs site aggregating community best practices for Claude Code. Covers document structures, MDX content, and navigable routes for scalable documentation.

best-practicesdocumentationreferencecommunity
Mar 10, 2026 6/10
skill Reddit

Configuring CLAUDE.md to Explain Code While Vibe Coding

Community question on how to tune your global CLAUDE.md so Claude explains its reasoning and code in accessible terms as it builds. Useful starting point for learners who want to ship real apps while building their coding knowledge alongside Claude.

claude.mdlearningvibe-codingbeginnerexplanations
by /u/Wheels859 Mar 10, 2026 6/10
skill GitHub

Code Sensei: Learn Programming While Vibe-Coding with Claude Code

A free, open-source Claude Code plugin that teaches programming as you work. Provides contextual explanations, micro-quizzes, and a belt progression system to gamify learning. Unique in targeting developers who want to understand what Claude Code is doing, not just let it run.

educationlearningpluginclaude-codegamificationquizzesopen-source
by DojoCodingLabs Mar 10, 2026 7/10
skill GitHub

Eden Skills: Fast, Deterministic Skills Manager for Claude Code and AI Agents

A skills manager for AI agents — Claude Code, Cursor, Codex, and more — focused on deterministic behavior and speed. Manages and organizes agent skills so they can be reliably discovered and invoked. Addresses the growing need for structured skill registries as agent skill ecosystems mature.

skills-manageragent-skillsclaude-codecursorcodexdeterministic
by AI-Eden Mar 10, 2026 7/10
skill GitHub

Bitrefill Agent Skills: Buy Gift Cards and eSIMs from Claude Code

Agent skills for Bitrefill that let AI coding agents browse, buy, and manage gift cards, mobile top-ups, and eSIMs. Compliant with the Agent Skills spec and works with Claude Code, Cursor, and npx skills. A concrete example of real-world commerce actions exposed as agent skills.

agent-skillsbitrefille-commercegift-cardsclaude-codecursor
by bitrefill Mar 10, 2026 5/10
skill GitHub

AI.MD: Convert CLAUDE.md to AI-Native Structured-Label Format

A tool that converts human-written CLAUDE.md files into an AI-native structured-label format, achieving the same rules with fewer tokens and higher model compliance. Battle-tested across 5 rounds and 4 models. A practical upgrade for anyone optimizing their CLAUDE.md for efficiency.

CLAUDE.mdtoken-optimizationstructured-formatconfigurationcompliance
by sstklen Mar 10, 2026 8/10
skill GitHub

Production-Ready Python Template for Claude Code with TDD and Multi-Agent Setup

A Python project template built for Claude Code with a TDD workflow baked in, 7 custom agents, and an 11-step Phase Completion Checklist. Provides a structured, opinionated starting point for Python projects that leverages Claude Code from day one. Good reference for teams establishing Claude Code conventions.

templatepythontddmulti-agentCLAUDE.mdworkflow
by stranma Mar 10, 2026 7/10
skill GitHub

SkillCheck-Free: Validate Claude Code skills against agentskills spec

Tool for validating Claude Code skills against the agentskills specification. Helps ensure your SKILL.md files are correctly structured and compliant with emerging standards for AI agent skills.

skillvalidationagentskillsspecSKILL.md
by olgasafonova Mar 9, 2026 5/10
skill GitHub

obsidian-skill: Manage Obsidian vaults with CLI tools via Claude Code

Claude Code skill providing CLI tools for managing Obsidian vaults — notes, tasks, tags, templates, and knowledge graph analysis. Bridges the gap between Obsidian knowledge management and AI-assisted development.

skillobsidianknowledge-managementnotescli
by wizzy15 Mar 9, 2026 6/10
skill GitHub

66 Claude AI skills and 9 workflows for full-stack developers

Comprehensive collection of 66 Claude AI skills and 9 workflows designed to enhance productivity for full-stack developers. Covers a wide range of development scenarios from frontend to backend and deployment.

skillfull-stackworkflowcollectionproductivity
by zacklecon Mar 9, 2026 6/10
skill Reddit

OpenAlgernon: Claude Code-native terminal study platform with FSRS spaced repetition

Study platform that installs as a Claude Code slash command and runs entirely in the terminal. Uses FSRS-4.5 for spaced repetition scheduling with Claude as the study engine. Designed for engineers with backlogs of papers, RAG handbooks, and agent playbooks to study.

skillspaced-repetitionlearningterminalslash-commandFSRS
by AntonioVFranco Mar 9, 2026 7/10
skill GitHub

Claude plans, Gemini implements: dual-agent manager skill

A Claude Code skill that orchestrates a two-agent system where Claude handles planning and verification while Gemini CLI executes the actual code implementation. Leverages strengths of both models in a structured divide-and-conquer workflow.

skillgeminiorchestrationplanningmulti-agent
by MikoChun Mar 9, 2026 7/10
skill Reddit

HELIX v2.0: Self-evolving Claude Code skill with MCP and context compression

Claude Code skill that evolves itself after every run by learning your coding style. Features native MCP for real API connections, context compression to fight context rot, 60% cost reduction via prompt caching, and agentic self-healing for broken code. Works on Claude Code and Gemini CLI.

skillself-evolvingmcpcontext-compressionprompt-cachingself-healing
by Caramaschi Mar 9, 2026 8/10
skill X

Curated Claude Code ecosystem list: CLAUDE.md templates, MCP directory, hook recipes, and more

A community-built index of Claude Code ecosystem resources: language-specific CLAUDE.md templates (TypeScript, Python, Next.js, homelab), an MCP server directory, hook recipes, CLI piping tricks, and workflow patterns. Built because the ecosystem was too scattered to navigate easily. High-signal starting point for new and experienced users alike.

curated-listclaude-mdmcphooksresources
by @1erkan Mar 9, 2026 8/10
skill Reddit

Claude Code skill for instant web analytics setup on new projects

A Claude Code skill that automates adding web analytics to any new project in seconds. Install with `npx skills add isaacaudet/web-analytics-setup`. Eliminates the repetitive manual setup that most developers redo on every project. Practical time-saver for frequent project starters.

skillsanalyticssetupautomation
by demars123 Mar 9, 2026 7/10
skill Reddit

How to debug Claude Code skills: 6 failure patterns from building MCP workflow chains

After building 7 Claude Code skills that chain MCP tool calls, the author cataloged the 6 most common failure patterns with concrete fixes for each. Covers issues like tool call ordering, error propagation, context loss, and MCP response handling. Practical debugging guide that applies to any skill calling MCP servers.

debuggingskillsmcpfailure-patterns
by mgdo Mar 9, 2026 8/10
skill GitHub

awesome-anthropic: Daily-updated curated list of Anthropic tools, resources, and projects

A maintained, daily-updated index of tools, resources, and community projects across the Anthropic ecosystem. Covers Claude Code, MCP, the API, and third-party integrations. Useful as a living reference for staying current without monitoring every forum and repo individually.

curated-listresourcesanthropicreference
by Boroldoi0402 Mar 9, 2026 5/10
skill GitHub

Awesome-Agent-Skills: Discovery hub for Claude Code, OpenAI, and MCP skills

A curated collection and navigation resource for AI agent skills across Claude Code, OpenAI, and MCP servers. Centralizes community-built skills to make them easier to discover and install. Good starting point for extending your agent's capabilities.

skillsdiscoverycurated-listmcp
by megalor1 Mar 9, 2026 5/10
skill GitHub

Custom Claude Code skills for port management and international translations

A collection of practical Claude Code skills targeting everyday dev friction: port conflict management and multilingual content translation. Covers real workflow pain points with reusable slash commands. A good example of targeted, single-purpose skill design.

skillsautomationproductivitycli
by danicuevas23 Mar 9, 2026 6/10
skill GitHub

claude-skills: Reusable slash-command workflows for reliable multi-step tasks

A collection of slash-command workflows specifically designed to make Claude Code reliable on complex, multi-step tasks where it commonly drifts or fails. Addresses real failure modes in agentic operations through structured skill patterns. A practical toolkit from an active Claude Code power user.

skillsslash-commandsreliabilityworkflow
by npow Mar 9, 2026 7/10
skill GitHub

everything-claude-code: Complete agent collection from an Anthropic hackathon winner

A comprehensive collection of Claude Code configurations, agents, and patterns refined over 10+ months by an Anthropic hackathon winner. Covers the full range from basic prompting to multi-agent orchestration. One of the most battle-tested Claude Code setups available publicly.

agentsconfigurationhackathonreference
by arabicapp Mar 9, 2026 8/10
skill GitHub

agent-skills: Shared skill collection for OpenClaw and Claude Code

A collection of agent skills designed to work with both OpenClaw and Claude Code. Provides reusable commands that extend your coding agent's capabilities with community-contributed workflows. Good resource for skill authors looking at cross-compatible patterns.

skillsopenclawcross-compatiblecommunity
by ZLHad Mar 9, 2026 5/10
skill GitHub

Claude Code skill for creating and editing PowerPoint presentations via XML

A Claude Code skill that generates and edits PowerPoint presentations using direct XML manipulation. Enables AI-assisted slide creation from within your development environment without external tools. Useful for developers who need to produce presentation deliverables alongside code.

skillspowerpointpresentationsoffice
by 24111999 Mar 9, 2026 5/10
skill GitHub

research-skills: Claude Code skills for literature reviews and paper-to-slide generation

Academic research skills for Claude Code covering literature review writing and automated slide generation from research papers. Bridges the gap between reading papers and producing research outputs. Designed for researchers and graduate students using AI in their academic workflow.

skillsresearchacademicpresentations
by Ronitnair Mar 9, 2026 5/10
skill GitHub

agent-skills-guide: Official + community guide to creating Claude Code agent skills

A comprehensive guide for creating and enhancing Agent Skills, drawing from official Anthropic documentation and community insights. Covers skill structure, tool integration, and effective prompt patterns. Good starting point for developers new to building Claude Code skills.

skillsguidedocumentationgetting-started
by kaydenplayZ Mar 9, 2026 5/10
skill X

Claude Code skill: convert plain-text to structured JSON image prompts for Nano Banana 2

A Claude Code skill that rewrites plain-text image descriptions into structured JSON prompts optimized for Nano Banana 2 (image generation model), producing professional-quality outputs. Demonstrates how Claude Code skills can bridge AI tools via prompt transformation.

skillimage-generationJSONprompt-engineering
by @TechWith_Nova Mar 9, 2026 6/10
skill GitHub

knowledge-foundation-starter: Stack-Agnostic Knowledge Governance Template

A reusable project template providing ADR, TLDR, and Roadmap systems with pre-configured AI agent and skill configs for Claude Code and Codex CLI. Designed to bring structured knowledge governance to any codebase regardless of stack.

templateCLAUDE.mdADRknowledge-managementcodex
by marioGusmao Mar 9, 2026 7/10
skill GitHub

Multi-Model Agent Implementation Skill for Claude Code

A Claude Code skill that orchestrates a full implementation workflow across multiple AI models: research, evaluation, design baseline, implementation, root cause analysis, and auditing. Designed to leverage each model's strengths at different stages of a task.

skillmulti-modelworkfloworchestrationaudit
by nestharus Mar 9, 2026 8/10
skill GitHub

Claude Scientific Skills: Research and Analysis Agent Skills Collection

A ready-to-use set of Claude agent skills covering research, science, engineering, analysis, finance, and writing. Provides domain-specific prompting patterns for technical and scientific work where Claude Code is used beyond pure software tasks.

skillresearchscienceengineeringanalysis
by K-Dense-AI Mar 9, 2026 7/10
skill GitHub

Comprehensive Claude Code Skills: Full Delivery Workflow Collection

A production-ready skills collection covering the complete delivery workflow: research, epic planning, task breakdown, implementation, testing, code review, and quality gates. Designed as a drop-in skill set for teams using Claude Code professionally.

skillworkflowproductioncode-reviewquality
by levnikolaevich Mar 9, 2026 8/10
skill GitHub

Android Reverse Engineering Skill for Claude Code

A Claude Code skill that wraps jadx to decompile Android APK, XAPK, AAB, DEX, JAR, and AAR files directly from your coding session. Useful for security researchers and developers analyzing third-party Android binaries.

skillandroidreverse-engineeringsecurityjadx
by incogbyte Mar 9, 2026 6/10
skill Reddit

Claude Code Skill: 6 Parallel Research Agents for Market Analysis

A Claude Code skill that dispatches 6 parallel research agents to analyze any market in ~20 minutes using real web data — reviews, pricing, forums, funding signals, and hiring trends. Demonstrated on the AI coding assistants market with 15 competitors analyzed.

skillresearchparallel-agentscompetitive-intelligencemarket-analysis
by ferdbons Mar 9, 2026 7/10
skill GitHub

claud-skills: Production-Ready Claude Code Agents with Auto-Generated Docs

A framework for building and using production-ready Claude Code agents and skills, with automatic documentation generation. Helps teams maintain a catalog of reusable agent behaviors with up-to-date documentation.

skillagentsdocumentationproductivity
by bloody2634 Mar 9, 2026 6/10
skill GitHub

claude-config: 16-Skill Professional Config with REEL Orchestrator

A one-command install providing professional Claude Code configuration: 16 curated skills, automated hooks, team coding standards enforcement, and the REEL autonomous orchestrator. Designed as a complete opinionated setup for teams adopting Claude Code at scale.

skillhooksorchestrationCLAUDE.mdteamconfiguration
by gsmethells Mar 9, 2026 8/10
skill GitHub

skill-codex: Claude Code Skill for Automated Analysis via Codex CLI

A Claude Code skill that enables automated code analysis and editing by leveraging Codex CLI under the hood. Useful for refactoring workflows where you want Claude Code to orchestrate Codex for specific transformation tasks.

skillcodexautomationrefactoringanalysis
by LightDopper Mar 9, 2026 6/10
skill GitHub

playwright-skill: Claude Skill for Dynamic Browser Automation

A Claude Code skill that executes dynamically generated Playwright code for browser automation tasks. Rather than writing Playwright scripts manually, you describe what you want and Claude generates and runs the automation on demand.

skillplaywrightbrowser-automationtesting
by jpulido240-svg Mar 9, 2026 7/10
skill GitHub

claude-skills-marketplace: System Architect Skill for Project Documentation

A Claude Code skill that transforms Claude into a System Architect, generating detailed project documentation with clear component boundaries and traceable requirements. Useful at project kickoff to produce structured specs before implementation begins.

skillarchitecturedocumentationrequirementsspecs
by 428alexander9 Mar 9, 2026 6/10
skill GitHub

Product-Manager-Skills: Battle-Tested PM Skills Framework for Claude Code

A product management skills framework built on proven PM methodologies, compatible with Claude Code, Cowork, Codex, and AI agents. Covers roadmapping, prioritization, stakeholder communication, and delivery — bridging PM work with AI-assisted engineering.

skillproduct-managementroadmapprioritizationmethodology
by deanpeters Mar 9, 2026 7/10
skill GitHub

startup-skill: AI Agent Skills for Startup Validation and Competitive Intel

A set of Claude Code agent skills targeting startup use cases: market validation, competitive intelligence, and planning. Designed for founders and product builders using Claude Code to accelerate pre-build research.

skillstartupcompetitive-intelligencevalidationplanning
by ferdinandobons Mar 9, 2026 6/10
skill Reddit

Claude + Telegram

Any skill that will help Claude understand the telegram’s premium features, its architecture. To use for deploying a new bot. submitted by /u/Mon3y_craft [link] [comments]

skill
by Mon3y_craft Mar 9, 2026 6/10
skill Reddit

Skills - should I include examples?

I've been playing with the design of my personal skills I've written. I have lots of code examples in them, because when I was asking Claude for guidance in writing them it encouraged me to do so. ...

skill
by lambda-legacy Mar 9, 2026 6/10
skill Reddit

Skill or Project

My idea is to submit text, or a pdf, for Claude to analyze and output specific quotes from it that are in a certain tone, word limit, and subject. I have used projects before and know they are good...

skill
by jawwajxy Mar 9, 2026 6/10
skill GitHub

Svelte 5 Development Skill for Claude Code

A Claude Code skill providing structured, token-efficient guidance for Svelte 5 development including best practices, real-world patterns, and expert insights. Gives Claude deep Svelte 5 context without bloating the context window.

Svelteskillfrontendtoken-efficient
by NikosDevMC Mar 9, 2026 6/10
skill GitHub

Full-Stack Skills for Claude Code: Cloudflare, React, Tailwind v4

A collection of Claude Code skills targeting modern full-stack development with Cloudflare Workers, React, Tailwind CSS v4, and AI integrations. Provides structured, up-to-date context so Claude can assist accurately with these stacks without hallucinating outdated APIs.

CloudflareReactTailwindskillsfull-stackAI-integration
by jezweb Mar 9, 2026 7/10
skill GitHub

Unofficial Swift Language Skill for Claude Code

A structured Claude Code skill providing comprehensive access to Swift Programming Language content, enabling Claude to give expert Swift guidance for iOS and macOS development. Covers core language features and common patterns from the official Swift book.

SwiftiOSmacOSskilllanguage
by Shada01245 Mar 9, 2026 5/10
skill GitHub

RubyCritic Skill for Ruby/Rails Code Quality Analysis

A Claude Code skill that integrates RubyCritic to surface code quality metrics, complexity scores, and technical debt insights for Ruby and Rails projects. Enables Claude to reason about and improve code quality as part of your development workflow.

RubyRailscode-qualityRubyCriticskillmetrics
by thairns Mar 9, 2026 6/10
skill GitHub

Gemini CLI Skill: Use Gemini Alongside Claude Code

A Claude Code skill that integrates Gemini CLI for code generation, review, testing, documentation, and architecture analysis. Lets Claude Code users leverage Gemini's capabilities within the same workflow for tasks where a second model opinion adds value.

Geminimulti-modelskillcode-reviewCLI
by Junayedahmedd Mar 9, 2026 6/10
skill GitHub

ast-grep Code Pattern Search Skill for Claude Code

A Claude Code skill that adds ast-grep-powered structural code search, letting Claude find patterns in codebases beyond simple text matching. Particularly useful for error handling audits, refactoring tasks, and enforcing coding conventions across large projects.

ast-grepcode-searchpatternsskillrefactoring
by Kayunangka Mar 9, 2026 6/10
skill GitHub

Multi-Agent Research Orchestration Skill for Claude Code

A Claude Code skill enabling orchestration of multi-agent research workflows with parallel subagent execution, structured audits, and workflow planning. Useful for complex investigations requiring breakdown across multiple specialized agents with result synthesis.

multi-agentresearchorchestrationparallelskill
by zubayer0077 Mar 9, 2026 7/10
skill Reddit

Use /loop on windows

Hi, I updated to 2.1.71 but when typing /loop nothing pop out and also If I try to use it saidd no skill found. Im on windows 11 submitted by /u/triko93 [link] [comments]

skill
by triko93 Mar 9, 2026 5/10
skill Reddit

Skills for claude.ai

Do you know of any cool skills for claude.ai for a WordPress FSE, SEO, copywriting, or design designer, social media post X, FB? I already have some, but maybe you can inspire me. Thanks in advance...

skill
by tomaszgiemza Mar 9, 2026 6/10
skill GitHub

baoyu-skills:

baoyu-skills:

skill
by JimLiu Mar 9, 2026 5/10